Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   HUO02_RS02000 Genome accession   NZ_CP054714
Coordinates   396994..397113 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain KKLW     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 391994..402113
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUO02_RS01985 (HUO02_01985) - 393606..394289 (+) 684 WP_007410267.1 response regulator transcription factor -
  HUO02_RS01990 (HUO02_01990) - 394276..395709 (+) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  HUO02_RS01995 (HUO02_01995) rapC 395862..397010 (+) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  HUO02_RS02000 (HUO02_02000) phrC 396994..397113 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HUO02_RS02005 (HUO02_02005) - 397262..397372 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  HUO02_RS02010 (HUO02_02010) - 397452..398816 (-) 1365 WP_012116801.1 aspartate kinase -
  HUO02_RS02015 (HUO02_02015) ceuB 399230..400183 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  HUO02_RS02020 (HUO02_02020) - 400173..401120 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  HUO02_RS02025 (HUO02_02025) - 401114..401872 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=454115 HUO02_RS02000 WP_003156334.1 396994..397113(+) (phrC) [Bacillus velezensis strain KKLW]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=454115 HUO02_RS02000 WP_003156334.1 396994..397113(+) (phrC) [Bacillus velezensis strain KKLW]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718