Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAXH7_RS15250 Genome accession   NC_017191
Coordinates   2999994..3000134 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens XH7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2994994..3005134
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAXH7_RS15225 (BAXH7_03217) - 2995313..2995696 (-) 384 WP_013353393.1 hotdog fold thioesterase -
  BAXH7_RS15230 (BAXH7_03218) comA 2995718..2996362 (-) 645 WP_014470899.1 response regulator transcription factor Regulator
  BAXH7_RS15235 - 2996443..2998749 (-) 2307 Protein_3036 sensor histidine kinase -
  BAXH7_RS15240 (BAXH7_03221) comX 2998772..2998948 (-) 177 WP_013353396.1 competence pheromone ComX -
  BAXH7_RS15245 (BAXH7_03222) - 2998967..2999842 (-) 876 WP_013353397.1 polyprenyl synthetase family protein -
  BAXH7_RS15250 (BAXH7_03223) degQ 2999994..3000134 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  BAXH7_RS15255 (BAXH7_03225) - 3000599..3000940 (+) 342 WP_013353399.1 hypothetical protein -
  BAXH7_RS15260 (BAXH7_03226) - 3000947..3002170 (-) 1224 WP_014470900.1 EAL and HDOD domain-containing protein -
  BAXH7_RS15265 (BAXH7_03227) - 3002300..3003766 (-) 1467 WP_014472199.1 nicotinate phosphoribosyltransferase -
  BAXH7_RS15270 (BAXH7_03228) - 3003784..3004335 (-) 552 WP_013353402.1 cysteine hydrolase family protein -
  BAXH7_RS15275 (BAXH7_03229) - 3004416..3004811 (-) 396 WP_013353403.1 YueI family protein -
  BAXH7_RS15280 (BAXH7_03230) - 3004877..3005125 (-) 249 WP_013353404.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=45349 BAXH7_RS15250 WP_013353398.1 2999994..3000134(-) (degQ) [Bacillus amyloliquefaciens XH7]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=45349 BAXH7_RS15250 WP_013353398.1 2999994..3000134(-) (degQ) [Bacillus amyloliquefaciens XH7]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment