Detailed information
Bioinformatically predicted
Overview
| Name | sinR | Type | Regulator |
| Locus tag | FOC75_RS04590 | Genome accession | NZ_CP053991 |
| Coordinates | 796588..796911 (-) | Length | 107 a.a. |
| NCBI ID | WP_000578878.1 | Uniprot ID | A0A6L7H7A6 |
| Organism | Bacillus cereus strain FDAARGOS_781 | ||
| Function | repression of rok; repression of degU; repression of spo0A (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 770254..799856 | 796588..796911 | within | 0 |
Gene organization within MGE regions
Location: 770254..799856
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOC75_RS04385 (FOC75_04385) | - | 770254..770463 (+) | 210 | WP_000428510.1 | helix-turn-helix transcriptional regulator | - |
| FOC75_RS04390 (FOC75_04390) | - | 770466..770843 (+) | 378 | WP_001109905.1 | hypothetical protein | - |
| FOC75_RS04395 (FOC75_04395) | - | 770872..771054 (+) | 183 | WP_001178301.1 | DUF3976 domain-containing protein | - |
| FOC75_RS04400 (FOC75_04400) | - | 771189..771545 (+) | 357 | WP_001036567.1 | hypothetical protein | - |
| FOC75_RS04405 (FOC75_04405) | - | 771564..771833 (+) | 270 | WP_001195372.1 | hypothetical protein | - |
| FOC75_RS29565 (FOC75_04410) | - | 771977..772318 (+) | 342 | Protein_768 | hypothetical protein | - |
| FOC75_RS04415 (FOC75_04415) | - | 772312..773055 (+) | 744 | Protein_769 | WXG100 family type VII secretion target | - |
| FOC75_RS04420 (FOC75_04420) | - | 773073..773264 (+) | 192 | WP_001182254.1 | hypothetical protein | - |
| FOC75_RS04425 (FOC75_04425) | - | 773293..773541 (+) | 249 | WP_000771628.1 | DUF4176 domain-containing protein | - |
| FOC75_RS04430 (FOC75_04430) | - | 773582..773770 (+) | 189 | WP_000516413.1 | hypothetical protein | - |
| FOC75_RS04435 (FOC75_04435) | - | 774417..774878 (-) | 462 | WP_000605456.1 | hypothetical protein | - |
| FOC75_RS04440 (FOC75_04440) | - | 775031..775615 (-) | 585 | WP_001086694.1 | hypothetical protein | - |
| FOC75_RS04445 (FOC75_04445) | - | 775701..776045 (-) | 345 | WP_000164232.1 | hypothetical protein | - |
| FOC75_RS04450 (FOC75_04450) | - | 776127..776906 (-) | 780 | WP_000191135.1 | hypothetical protein | - |
| FOC75_RS04455 (FOC75_04455) | - | 777013..777330 (-) | 318 | WP_002035977.1 | BRO family protein | - |
| FOC75_RS04460 (FOC75_04460) | - | 777509..777712 (-) | 204 | WP_000977940.1 | hypothetical protein | - |
| FOC75_RS04465 (FOC75_04465) | - | 777696..777899 (-) | 204 | WP_000511673.1 | hypothetical protein | - |
| FOC75_RS04470 (FOC75_04470) | - | 778091..778339 (-) | 249 | WP_001000828.1 | hypothetical protein | - |
| FOC75_RS04475 (FOC75_04475) | - | 778515..778835 (-) | 321 | WP_000230742.1 | hypothetical protein | - |
| FOC75_RS04480 (FOC75_04480) | - | 778825..779064 (-) | 240 | WP_000828804.1 | hypothetical protein | - |
| FOC75_RS04485 (FOC75_04485) | - | 779201..780526 (-) | 1326 | WP_001058016.1 | hypothetical protein | - |
| FOC75_RS04490 (FOC75_04490) | - | 781189..781335 (+) | 147 | WP_162484064.1 | hypothetical protein | - |
| FOC75_RS04495 (FOC75_04495) | - | 781372..781521 (+) | 150 | WP_157404510.1 | hypothetical protein | - |
| FOC75_RS04500 (FOC75_04500) | - | 781595..781939 (+) | 345 | WP_157404511.1 | HNH endonuclease | - |
| FOC75_RS04505 (FOC75_04505) | - | 782079..782519 (+) | 441 | WP_001153942.1 | phage terminase small subunit P27 family | - |
| FOC75_RS04510 (FOC75_04510) | - | 782516..782776 (+) | 261 | WP_000811159.1 | hypothetical protein | - |
| FOC75_RS04515 (FOC75_04515) | - | 782951..783196 (+) | 246 | WP_000874865.1 | hypothetical protein | - |
| FOC75_RS04520 (FOC75_04520) | - | 783487..784788 (+) | 1302 | WP_000896384.1 | phage portal protein | - |
| FOC75_RS04525 (FOC75_04525) | - | 784781..786517 (+) | 1737 | WP_001003089.1 | phage major capsid protein | - |
| FOC75_RS04530 (FOC75_04530) | - | 786825..787319 (-) | 495 | WP_000093742.1 | hypothetical protein | - |
| FOC75_RS04535 (FOC75_04535) | - | 787461..788198 (-) | 738 | WP_000334962.1 | hypothetical protein | - |
| FOC75_RS04540 (FOC75_04540) | - | 788322..789407 (-) | 1086 | WP_000060403.1 | tyrosine-type recombinase/integrase | - |
| FOC75_RS04550 (FOC75_04550) | - | 789790..790014 (-) | 225 | WP_000090210.1 | hypothetical protein | - |
| FOC75_RS04555 (FOC75_04555) | - | 790292..791047 (-) | 756 | WP_000858633.1 | class I SAM-dependent methyltransferase | - |
| FOC75_RS04560 (FOC75_04560) | - | 791413..791640 (+) | 228 | WP_000251855.1 | hypothetical protein | - |
| FOC75_RS04565 (FOC75_04565) | - | 791796..793082 (+) | 1287 | WP_000247011.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| FOC75_RS04570 (FOC75_04570) | sipW | 793274..793843 (+) | 570 | WP_000767813.1 | signal peptidase I SipW | - |
| FOC75_RS04575 (FOC75_04575) | - | 793906..794493 (+) | 588 | WP_000172840.1 | CalY family protein | - |
| FOC75_RS04580 (FOC75_04580) | - | 794655..795521 (+) | 867 | WP_000917469.1 | DUF4047 domain-containing protein | - |
| FOC75_RS04585 (FOC75_04585) | calY | 795919..796512 (+) | 594 | WP_000053731.1 | biofilm matrix protein CalY | - |
| FOC75_RS04590 (FOC75_04590) | sinR | 796588..796911 (-) | 324 | WP_000578878.1 | helix-turn-helix domain-containing protein | Regulator |
| FOC75_RS04595 (FOC75_04595) | - | 796991..797125 (-) | 135 | WP_000276214.1 | anti-repressor SinI family protein | - |
| FOC75_RS04600 (FOC75_04600) | inhA1 | 797469..799856 (+) | 2388 | WP_001035926.1 | M6 family metalloprotease immune inhibitor InhA1 | - |
Sequence
Protein
Download Length: 107 a.a. Molecular weight: 12319.17 Da Isoelectric Point: 9.6244
>NTDB_id=449830 FOC75_RS04590 WP_000578878.1 796588..796911(-) (sinR) [Bacillus cereus strain FDAARGOS_781]
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDTLLHDETTKEANLDSEWTQLV
KDAMNSGVSKEQFREFLEFTKWKQNQK
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDTLLHDETTKEANLDSEWTQLV
KDAMNSGVSKEQFREFLEFTKWKQNQK
Nucleotide
Download Length: 324 bp
>NTDB_id=449830 FOC75_RS04590 WP_000578878.1 796588..796911(-) (sinR) [Bacillus cereus strain FDAARGOS_781]
ATGATTGGAGAACGTATAAAACGCCTTCGTTTACAAAAAGGTATTTCATTAACTGAACTTGCCGAAAAAGCTGGCGTTGC
TAAATCTTACATTAGTTCTATAGAACGAAATTTACAAAAGAACCCTTCCATTCAGTTTCTTGAAAAGATCGCAGCAGTTC
TACAAATTCCAGTTGATACTTTACTTCATGATGAAACAACAAAGGAAGCTAACCTAGACTCCGAATGGACACAGCTCGTC
AAAGATGCAATGAACTCTGGTGTCTCCAAAGAACAATTTCGTGAATTTCTTGAATTTACAAAATGGAAGCAAAATCAAAA
ATAA
ATGATTGGAGAACGTATAAAACGCCTTCGTTTACAAAAAGGTATTTCATTAACTGAACTTGCCGAAAAAGCTGGCGTTGC
TAAATCTTACATTAGTTCTATAGAACGAAATTTACAAAAGAACCCTTCCATTCAGTTTCTTGAAAAGATCGCAGCAGTTC
TACAAATTCCAGTTGATACTTTACTTCATGATGAAACAACAAAGGAAGCTAACCTAGACTCCGAATGGACACAGCTCGTC
AAAGATGCAATGAACTCTGGTGTCTCCAAAGAACAATTTCGTGAATTTCTTGAATTTACAAAATGGAAGCAAAATCAAAA
ATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinR | Bacillus subtilis subsp. subtilis str. 168 |
67.89 |
100 |
0.692 |