Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   FOC76_RS19255 Genome accession   NZ_CP053955
Coordinates   3740477..3740755 (-) Length   92 a.a.
NCBI ID   WP_000799079.1    Uniprot ID   -
Organism   Bacillus tropicus strain FDAARGOS_782     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3707438..3751093 3740477..3740755 within 0


Gene organization within MGE regions


Location: 3707438..3751093
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC76_RS19065 (FOC76_19065) - 3707438..3708505 (-) 1068 WP_000753403.1 peptidoglycan recognition family protein -
  FOC76_RS19070 (FOC76_19070) - 3708502..3708741 (-) 240 WP_000254143.1 hypothetical protein -
  FOC76_RS19075 (FOC76_19075) - 3708741..3708977 (-) 237 WP_000398745.1 hemolysin XhlA family protein -
  FOC76_RS19080 (FOC76_19080) - 3709016..3713011 (-) 3996 WP_001260170.1 phage tail spike protein -
  FOC76_RS19085 (FOC76_19085) - 3713008..3714447 (-) 1440 WP_002021505.1 distal tail protein Dit -
  FOC76_RS19090 (FOC76_19090) - 3714513..3718343 (-) 3831 WP_001262735.1 phage tail tape measure protein -
  FOC76_RS19095 (FOC76_19095) - 3718359..3718535 (-) 177 WP_000344045.1 hypothetical protein -
  FOC76_RS19100 (FOC76_19100) - 3718565..3718879 (-) 315 WP_000778621.1 hypothetical protein -
  FOC76_RS19105 (FOC76_19105) - 3718929..3719537 (-) 609 WP_000896779.1 major tail protein -
  FOC76_RS19110 (FOC76_19110) - 3719538..3719897 (-) 360 WP_000609199.1 DUF3168 domain-containing protein -
  FOC76_RS19115 (FOC76_19115) - 3719894..3720331 (-) 438 WP_000763227.1 HK97-gp10 family putative phage morphogenesis protein -
  FOC76_RS19120 (FOC76_19120) - 3720324..3720647 (-) 324 WP_001068014.1 phage head closure protein -
  FOC76_RS19125 (FOC76_19125) - 3720644..3720922 (-) 279 WP_000244595.1 head-tail connector protein -
  FOC76_RS19130 (FOC76_19130) - 3720943..3722115 (-) 1173 WP_000361135.1 phage major capsid protein -
  FOC76_RS19135 (FOC76_19135) - 3722153..3722863 (-) 711 WP_001259157.1 head maturation protease, ClpP-related -
  FOC76_RS19140 (FOC76_19140) - 3722850..3724103 (-) 1254 WP_000577487.1 phage portal protein -
  FOC76_RS19145 (FOC76_19145) - 3724292..3725986 (-) 1695 WP_000621125.1 terminase large subunit -
  FOC76_RS19150 (FOC76_19150) - 3725988..3726491 (-) 504 WP_000251639.1 phage terminase small subunit P27 family -
  FOC76_RS19155 (FOC76_19155) - 3726621..3726998 (-) 378 WP_001139458.1 HNH endonuclease -
  FOC76_RS19160 (FOC76_19160) - 3726988..3727242 (-) 255 WP_001198491.1 hypothetical protein -
  FOC76_RS19165 (FOC76_19165) - 3727261..3727467 (-) 207 WP_000777414.1 hypothetical protein -
  FOC76_RS19170 (FOC76_19170) - 3727467..3727622 (-) 156 WP_162484126.1 hypothetical protein -
  FOC76_RS19175 (FOC76_19175) - 3727765..3728145 (+) 381 WP_000773979.1 DUF2513 domain-containing protein -
  FOC76_RS19180 (FOC76_19180) - 3728142..3728375 (-) 234 WP_000127963.1 hypothetical protein -
  FOC76_RS19185 (FOC76_19185) - 3728750..3729646 (-) 897 WP_001209235.1 hypothetical protein -
  FOC76_RS19190 (FOC76_19190) - 3730289..3730669 (+) 381 WP_000446226.1 SET domain-containing protein -
  FOC76_RS19195 (FOC76_19195) - 3730840..3731892 (+) 1053 WP_000113638.1 S8 family serine peptidase -
  FOC76_RS19200 (FOC76_19200) - 3733013..3733717 (-) 705 WP_000158572.1 hypothetical protein -
  FOC76_RS19205 (FOC76_19205) - 3734389..3734931 (-) 543 WP_001012105.1 site-specific integrase -
  FOC76_RS19210 (FOC76_19210) - 3734931..3735413 (-) 483 WP_000166203.1 ArpU family phage packaging/lysis transcriptional regulator -
  FOC76_RS19215 (FOC76_19215) - 3735441..3735611 (-) 171 WP_000677453.1 hypothetical protein -
  FOC76_RS19220 (FOC76_19220) - 3735727..3735849 (-) 123 WP_002021485.1 DUF3983 domain-containing protein -
  FOC76_RS27320 - 3736196..3736450 (+) 255 WP_000682207.1 hypothetical protein -
  FOC76_RS19225 (FOC76_19225) - 3736601..3736828 (-) 228 WP_000227777.1 hypothetical protein -
  FOC76_RS19230 (FOC76_19230) - 3737806..3738951 (+) 1146 WP_000343917.1 collagen-like protein -
  FOC76_RS19235 (FOC76_19235) - 3739133..3739642 (-) 510 WP_001054606.1 dUTP diphosphatase -
  FOC76_RS19240 (FOC76_19240) - 3739662..3739913 (-) 252 WP_000109493.1 hypothetical protein -
  FOC76_RS19245 (FOC76_19245) - 3739939..3740106 (-) 168 WP_000717820.1 DUF3954 domain-containing protein -
  FOC76_RS19250 (FOC76_19250) - 3740125..3740484 (-) 360 WP_001125953.1 hypothetical protein -
  FOC76_RS19255 (FOC76_19255) abrB 3740477..3740755 (-) 279 WP_000799079.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  FOC76_RS19260 (FOC76_19260) - 3740772..3740966 (-) 195 WP_000337989.1 hypothetical protein -
  FOC76_RS19265 (FOC76_19265) - 3740969..3741832 (-) 864 WP_001148232.1 ATP-binding protein -
  FOC76_RS19270 (FOC76_19270) - 3741780..3742502 (-) 723 WP_000190241.1 DnaD domain protein -
  FOC76_RS19275 (FOC76_19275) - 3742696..3742860 (-) 165 WP_000390254.1 hypothetical protein -
  FOC76_RS19280 (FOC76_19280) - 3742860..3743126 (-) 267 WP_000522016.1 helix-turn-helix domain-containing protein -
  FOC76_RS19285 (FOC76_19285) - 3743248..3743457 (-) 210 WP_048567700.1 helix-turn-helix domain-containing protein -
  FOC76_RS19290 (FOC76_19290) - 3743626..3743964 (+) 339 WP_000041816.1 helix-turn-helix domain-containing protein -
  FOC76_RS19295 (FOC76_19295) - 3743984..3744124 (-) 141 WP_000527328.1 hypothetical protein -
  FOC76_RS19300 (FOC76_19300) - 3744245..3744394 (-) 150 WP_000724592.1 hypothetical protein -
  FOC76_RS19305 (FOC76_19305) - 3744407..3745504 (-) 1098 WP_001045097.1 AimR family lysis-lysogeny pheromone receptor -
  FOC76_RS19310 (FOC76_19310) - 3746123..3747325 (-) 1203 WP_033692786.1 exosporium leader peptide-containing protein -
  FOC76_RS19315 (FOC76_19315) - 3747630..3748739 (+) 1110 WP_000675848.1 tyrosine-type recombinase/integrase -
  FOC76_RS19320 (FOC76_19320) - 3748823..3749479 (-) 657 Protein_3739 DUF3962 domain-containing protein -
  FOC76_RS19325 (FOC76_19325) - 3749781..3750260 (-) 480 WP_000569107.1 hypothetical protein -
  FOC76_RS19330 (FOC76_19330) - 3750427..3750610 (-) 184 Protein_3741 site-specific integrase -
  FOC76_RS19335 (FOC76_19335) - 3750794..3751093 (-) 300 WP_001071397.1 heterocycloanthracin/sonorensin family bacteriocin -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10039.58 Da        Isoelectric Point: 6.7197

>NTDB_id=449448 FOC76_RS19255 WP_000799079.1 3740477..3740755(-) (abrB) [Bacillus tropicus strain FDAARGOS_782]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGESIVLRKHEKSCFVTGEVSESNMEFLGGRMFLSKAGANEL
LDALEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=449448 FOC76_RS19255 WP_000799079.1 3740477..3740755(-) (abrB) [Bacillus tropicus strain FDAARGOS_782]
ATGAAAAATACAGGTGTTGCAAGAAAAGTGGATGAGCTGGGGCGTGTAGTAATTCCGGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAACAGCATTAGACTTTCATGTTGATGGGGAAAGCATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTTCTGGGCGGTCGAATGTTTTTGAGTAAAGCGGGAGCAAATGAGTTA
CTTGATGCTCTTGAAAAGAGTGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

53.846

98.913

0.533