Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   STR1_RS04780 Genome accession   NZ_CP065486
Coordinates   916321..916521 (+) Length   66 a.a.
NCBI ID   WP_006531882.1    Uniprot ID   A0ABP2DHE2
Organism   Streptococcus thermophilus strain R1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 911321..921521
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STR1_RS04735 (STR1_04735) - 912959..913180 (+) 222 WP_101415610.1 Blp family class II bacteriocin -
  STR1_RS04740 (STR1_04740) - 913232..913459 (+) 228 WP_058621356.1 bacteriocin class II family protein -
  STR1_RS04745 (STR1_04745) - 913481..913864 (+) 384 WP_095559354.1 hypothetical protein -
  STR1_RS04750 (STR1_04750) - 913861..914064 (+) 204 Protein_891 garvicin Q family class II bacteriocin -
  STR1_RS04755 (STR1_04755) - 914076..914378 (+) 303 WP_015695689.1 bacteriocin immunity protein -
  STR1_RS04760 (STR1_04760) - 914536..914769 (+) 234 WP_095559355.1 Blp family class II bacteriocin -
  STR1_RS04765 (STR1_04765) - 914959..915216 (+) 258 WP_095559356.1 garvicin Q family class II bacteriocin -
  STR1_RS04770 (STR1_04770) - 915216..915524 (+) 309 WP_018364976.1 bacteriocin immunity protein -
  STR1_RS04775 (STR1_04775) - 915899..916078 (+) 180 WP_095559357.1 hypothetical protein -
  STR1_RS04780 (STR1_04780) cipB 916321..916521 (+) 201 WP_006531882.1 bacteriocin class II family protein Regulator
  STR1_RS04785 (STR1_04785) - 916547..916729 (+) 183 WP_006531883.1 Blp family class II bacteriocin -
  STR1_RS04790 (STR1_04790) - 917346..917576 (+) 231 WP_043878356.1 bacteriocin -
  STR1_RS04795 (STR1_04795) - 917665..917976 (+) 312 WP_003066586.1 hypothetical protein -
  STR1_RS04800 (STR1_04800) - 918190..918282 (+) 93 Protein_901 Blp family class II bacteriocin -
  STR1_RS04805 (STR1_04805) - 918340..918744 (+) 405 WP_015695682.1 hypothetical protein -
  STR1_RS04810 (STR1_04810) - 918925..919971 (+) 1047 WP_095559358.1 thioredoxin fold domain-containing protein -
  STR1_RS04815 (STR1_04815) - 920503..921267 (+) 765 WP_232086163.1 DUF6261 family protein -

Sequence

Protein


Download         Length: 66 a.a.        Molecular weight: 6536.51 Da        Isoelectric Point: 6.1394

>NTDB_id=448316 STR1_RS04780 WP_006531882.1 916321..916521(+) (cipB) [Streptococcus thermophilus strain R1]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR

Nucleotide


Download         Length: 201 bp        

>NTDB_id=448316 STR1_RS04780 WP_006531882.1 916321..916521(+) (cipB) [Streptococcus thermophilus strain R1]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.174

69.697

0.364