Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   HP432_RS12545 Genome accession   NZ_CP053730
Coordinates   2446243..2446872 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain CP61_Sichuan     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2418407..2456042 2446243..2446872 within 0


Gene organization within MGE regions


Location: 2418407..2456042
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HP432_RS12415 (HP432_12415) ssuD 2418612..2419757 (-) 1146 WP_000056006.1 FMNH2-dependent alkanesulfonate monooxygenase -
  HP432_RS12420 (HP432_12420) ssuA 2419754..2420713 (-) 960 WP_001244308.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  HP432_RS12425 (HP432_12425) ssuE 2420706..2421281 (-) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  HP432_RS12430 (HP432_12430) - 2421637..2422173 (+) 537 WP_250187914.1 fimbrial protein -
  HP432_RS12440 (HP432_12440) - 2423417..2423512 (+) 96 Protein_2263 fimbrial protein -
  HP432_RS12445 (HP432_12445) elfD 2423595..2424296 (+) 702 WP_001295349.1 molecular chaperone -
  HP432_RS12450 (HP432_12450) elfC 2424321..2426921 (+) 2601 WP_000286319.1 fimbrial biogenesis usher protein -
  HP432_RS12455 (HP432_12455) elfG 2426912..2427982 (+) 1071 WP_001165668.1 fimbrial protein -
  HP432_RS12460 (HP432_12460) ycbU 2427994..2428536 (+) 543 WP_000730614.1 fimbrial protein -
  HP432_RS12465 (HP432_12465) ycbV 2428544..2429059 (+) 516 WP_000919497.1 fimbrial protein -
  HP432_RS12470 (HP432_12470) ycbF 2429025..2429762 (+) 738 WP_162702279.1 fimbrial chaperone -
  HP432_RS12475 (HP432_12475) pyrD 2429873..2430883 (+) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  HP432_RS12480 (HP432_12480) zapC 2431057..2431599 (+) 543 WP_001295353.1 cell division protein ZapC -
  HP432_RS12485 (HP432_12485) ycbX 2431596..2432705 (-) 1110 WP_094322461.1 6-N-hydroxylaminopurine resistance protein YcbX -
  HP432_RS12490 (HP432_12490) rlmKL 2432949..2435057 (+) 2109 WP_001086539.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  HP432_RS12495 (HP432_12495) uup 2435069..2436976 (+) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  HP432_RS12500 (HP432_12500) pqiA 2437106..2438359 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  HP432_RS12505 (HP432_12505) pqiB 2438364..2440004 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  HP432_RS12510 (HP432_12510) pqiC 2440001..2440564 (+) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  HP432_RS12515 (HP432_12515) rmf 2440820..2440987 (+) 168 WP_000828648.1 ribosome modulation factor -
  HP432_RS12520 (HP432_12520) fabA 2441057..2441575 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  HP432_RS12525 (HP432_12525) ycbZ 2441644..2443404 (-) 1761 WP_001489425.1 Lon protease family protein -
  HP432_RS12530 (HP432_12530) matP 2443590..2444042 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  HP432_RS12535 (HP432_12535) ompA 2444118..2445158 (-) 1041 WP_172615727.1 porin OmpA -
  HP432_RS12540 (HP432_12540) sulA 2445515..2446024 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  HP432_RS12545 (HP432_12545) sxy/tfoX 2446243..2446872 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  HP432_RS12550 (HP432_12550) yccS 2446835..2448997 (-) 2163 WP_000875061.1 YccS family putative transporter -
  HP432_RS12555 (HP432_12555) yccF 2449007..2449453 (-) 447 WP_001261235.1 YccF domain-containing protein -
  HP432_RS12560 (HP432_12560) helD 2449576..2451630 (+) 2055 WP_001295354.1 DNA helicase IV -
  HP432_RS12565 (HP432_12565) mgsA 2451662..2452120 (-) 459 WP_000424181.1 methylglyoxal synthase -
  HP432_RS12570 (HP432_12570) yccT 2452215..2452877 (-) 663 WP_000847791.1 DUF2057 family protein -
  HP432_RS12575 (HP432_12575) yccU 2453050..2453463 (+) 414 WP_001301418.1 CoA-binding protein -
  HP432_RS12580 (HP432_12580) hspQ 2453507..2453824 (-) 318 WP_001295356.1 heat shock protein HspQ -
  HP432_RS12585 (HP432_12585) rlmI 2453882..2455072 (-) 1191 WP_172615728.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  HP432_RS12590 (HP432_12590) yccX 2455167..2455445 (+) 279 WP_000048252.1 acylphosphatase -
  HP432_RS12595 (HP432_12595) tusE 2455442..2455771 (-) 330 WP_000904442.1 sulfurtransferase TusE -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=446707 HP432_RS12545 WP_000839153.1 2446243..2446872(+) (sxy/tfoX) [Escherichia coli strain CP61_Sichuan]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=446707 HP432_RS12545 WP_000839153.1 2446243..2446872(+) (sxy/tfoX) [Escherichia coli strain CP61_Sichuan]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1