Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BANAU_RS16140 Genome accession   NC_017061
Coordinates   3280307..3280447 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis YAU B9601-Y2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3275307..3285447
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BANAU_RS16115 (BANAU_3064) - 3275621..3276004 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  BANAU_RS16120 (BANAU_3065) comA 3276026..3276670 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  BANAU_RS16125 (BANAU_3066) comP 3276751..3279102 (-) 2352 WP_014418763.1 sensor histidine kinase Regulator
  BANAU_RS16130 comX 3279080..3279250 (-) 171 WP_032863917.1 competence pheromone ComX -
  BANAU_RS16135 (BANAU_3067) - 3279250..3280155 (-) 906 WP_014418764.1 polyprenyl synthetase family protein -
  BANAU_RS16140 (BANAU_3068) degQ 3280307..3280447 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BANAU_RS16145 (BANAU_3069) - 3280913..3281254 (+) 342 WP_014418765.1 hypothetical protein -
  BANAU_RS16150 (BANAU_3070) - 3281261..3282484 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  BANAU_RS16155 (BANAU_3071) - 3282614..3284080 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BANAU_RS16160 (BANAU_3072) - 3284098..3284649 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BANAU_RS16165 (BANAU_3073) - 3284746..3285144 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=44640 BANAU_RS16140 WP_003152043.1 3280307..3280447(-) (degQ) [Bacillus velezensis YAU B9601-Y2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=44640 BANAU_RS16140 WP_003152043.1 3280307..3280447(-) (degQ) [Bacillus velezensis YAU B9601-Y2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment