Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   I3J23_RS05215 Genome accession   NZ_CP065159
Coordinates   1000598..1000777 (-) Length   59 a.a.
NCBI ID   WP_306383677.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain GXU-1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 995598..1005777
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I3J23_RS05185 (I3J23_05185) - 995987..996463 (+) 477 WP_003152059.1 Na+/H+ antiporter subunit E -
  I3J23_RS05190 (I3J23_05190) - 996463..996747 (+) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  I3J23_RS05195 (I3J23_05195) mnhG 996731..997105 (+) 375 WP_046560012.1 monovalent cation/H(+) antiporter subunit G -
  I3J23_RS05200 (I3J23_05200) - 997145..997528 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  I3J23_RS05205 (I3J23_05205) comA 997550..998194 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  I3J23_RS05210 (I3J23_05210) comP 998275..1000578 (-) 2304 WP_207579565.1 histidine kinase Regulator
  I3J23_RS05215 (I3J23_05215) comX 1000598..1000777 (-) 180 WP_306383677.1 competence pheromone ComX Regulator
  I3J23_RS05220 (I3J23_05220) comQ 1000731..1001717 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  I3J23_RS05225 (I3J23_05225) degQ 1001848..1001988 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  I3J23_RS05235 (I3J23_05235) - 1002454..1002795 (+) 342 WP_046560014.1 hypothetical protein -
  I3J23_RS05240 (I3J23_05240) - 1002802..1004022 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  I3J23_RS05245 (I3J23_05245) - 1004152..1005618 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 59 a.a.        Molecular weight: 6965.10 Da        Isoelectric Point: 6.1890

>NTDB_id=445769 I3J23_RS05215 WP_306383677.1 1000598..1000777(-) (comX) [Bacillus amyloliquefaciens strain GXU-1]
MMKMQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 180 bp        

>NTDB_id=445769 I3J23_RS05215 WP_306383677.1 1000598..1000777(-) (comX) [Bacillus amyloliquefaciens strain GXU-1]
ATGATGAAGATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAG
CCTTATCGGTTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATA
AAAAATGGGATAATGAATAA

Domains

Predicted by InterProScan.

Bacillus competence pheromone ComX (ComX)

(3-45)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

89.831

0.475