NTDB

Overview

Name	comGD	Type	Machinery gene
Locus tag	ICC24_RS13530	Genome accession	NZ_CP065029
Coordinates	2610929..2611366 (-)	Length	145 a.a.
NCBI ID	WP_071583679.1	Uniprot ID	-
Organism	Bacillus licheniformis strain LCDD6
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2605929..2616366

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ICC24_RS13480 (ICC24_13480)	sinI	2606098..2606274 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
ICC24_RS13485 (ICC24_13485)	sinR	2606308..2606643 (+)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
ICC24_RS13490 (ICC24_13490)	tasA	2606748..2607542 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
ICC24_RS13495 (ICC24_13495)	sipW	2607616..2608200 (-)	585	WP_003183449.1	signal peptidase I SipW	-
ICC24_RS13500 (ICC24_13500)	tapA	2608197..2608925 (-)	729	WP_011198112.1	amyloid fiber anchoring/assembly protein TapA	-
ICC24_RS13505 (ICC24_13505)	-	2609202..2609522 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
ICC24_RS13510 (ICC24_13510)	-	2609552..2609734 (-)	183	WP_003183456.1	YqzE family protein	-
ICC24_RS13515 (ICC24_13515)	comGG	2609823..2610188 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
ICC24_RS13520 (ICC24_13520)	comGF	2610201..2610689 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
ICC24_RS13525 (ICC24_13525)	comGE	2610598..2610945 (-)	348	WP_026699160.1	competence type IV pilus minor pilin ComGE	-
ICC24_RS13530 (ICC24_13530)	comGD	2610929..2611366 (-)	438	WP_071583679.1	competence type IV pilus minor pilin ComGD	Machinery gene
ICC24_RS13535 (ICC24_13535)	comGC	2611372..2611665 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
ICC24_RS13540 (ICC24_13540)	comGB	2611679..2612713 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
ICC24_RS13545 (ICC24_13545)	comGA	2612703..2613767 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
ICC24_RS13550 (ICC24_13550)	-	2613924..2614763 (-)	840	WP_071583678.1	STAS domain-containing protein	-
ICC24_RS13560 (ICC24_13560)	-	2615005..2615382 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
ICC24_RS13565 (ICC24_13565)	-	2615591..2615836 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

Download Length: 145 a.a. Molecular weight: 16291.15 Da Isoelectric Point: 9.6739

                                >NTDB_id=445425 ICC24_RS13530 WP_071583679.1 2610929..2611366(-) (comGD) [Bacillus licheniformis strain LCDD6]

MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD

EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQVGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

Download Length: 438 bp

                                >NTDB_id=445425 ICC24_RS13530 WP_071583679.1 2610929..2611366(-) (comGD) [Bacillus licheniformis strain LCDD6]

ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC

TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC

AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC

GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC

TTTTAATCCAAGCGGTGTTCCGAATCAAGTGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT

ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(2-25)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.161	98.621	0.386

Detailed information NTG0445425