Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HNO13_RS14780 Genome accession   NZ_CP053377
Coordinates   3055735..3055875 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain EN01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3050735..3060875
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO13_RS14755 (HNO13_14800) - 3051075..3051458 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  HNO13_RS14760 (HNO13_14805) comA 3051480..3052124 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  HNO13_RS14765 (HNO13_14810) comP 3052205..3054496 (-) 2292 WP_083058699.1 histidine kinase Regulator
  HNO13_RS14770 (HNO13_14815) comX 3054508..3054672 (-) 165 WP_007613432.1 competence pheromone ComX -
  HNO13_RS14775 (HNO13_14820) - 3054672..3055550 (-) 879 WP_024085740.1 polyprenyl synthetase family protein -
  HNO13_RS14780 (HNO13_14825) degQ 3055735..3055875 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HNO13_RS14785 (HNO13_14830) - 3056341..3056682 (+) 342 WP_014305721.1 hypothetical protein -
  HNO13_RS14790 (HNO13_14835) - 3056689..3057909 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  HNO13_RS14795 (HNO13_14840) - 3058039..3059505 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  HNO13_RS14800 (HNO13_14845) - 3059523..3060074 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  HNO13_RS14805 (HNO13_14850) - 3060171..3060569 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=444569 HNO13_RS14780 WP_003152043.1 3055735..3055875(-) (degQ) [Bacillus velezensis strain EN01]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=444569 HNO13_RS14780 WP_003152043.1 3055735..3055875(-) (degQ) [Bacillus velezensis strain EN01]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891