Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HNO12_RS11870 | Genome accession | NZ_CP053376 |
| Coordinates | 2504532..2504705 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain WF02 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2499532..2509705
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HNO12_RS11855 (HNO12_11890) | gcvT | 2500347..2501447 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HNO12_RS11860 (HNO12_11895) | - | 2501873..2503543 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| HNO12_RS11865 (HNO12_11900) | - | 2503561..2504355 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| HNO12_RS11870 (HNO12_11905) | sinI | 2504532..2504705 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| HNO12_RS11875 (HNO12_11910) | sinR | 2504739..2505074 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| HNO12_RS11880 (HNO12_11915) | tasA | 2505122..2505907 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| HNO12_RS11885 (HNO12_11920) | sipW | 2505971..2506555 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| HNO12_RS11890 (HNO12_11925) | tapA | 2506527..2507198 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HNO12_RS11895 (HNO12_11930) | - | 2507458..2507787 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| HNO12_RS11900 (HNO12_11935) | - | 2507827..2508006 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| HNO12_RS11905 (HNO12_11940) | comGG | 2508063..2508440 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HNO12_RS11910 (HNO12_11945) | comGF | 2508441..2508941 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| HNO12_RS11915 (HNO12_11950) | comGE | 2508850..2509164 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| HNO12_RS11920 (HNO12_11955) | comGD | 2509148..2509585 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=444471 HNO12_RS11870 WP_003153105.1 2504532..2504705(+) (sinI) [Bacillus amyloliquefaciens strain WF02]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=444471 HNO12_RS11870 WP_003153105.1 2504532..2504705(+) (sinI) [Bacillus amyloliquefaciens strain WF02]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |