Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HNO12_RS11870 Genome accession   NZ_CP053376
Coordinates   2504532..2504705 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain WF02     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2499532..2509705
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO12_RS11855 (HNO12_11890) gcvT 2500347..2501447 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  HNO12_RS11860 (HNO12_11895) - 2501873..2503543 (+) 1671 WP_003153107.1 SNF2-related protein -
  HNO12_RS11865 (HNO12_11900) - 2503561..2504355 (+) 795 WP_003153106.1 YqhG family protein -
  HNO12_RS11870 (HNO12_11905) sinI 2504532..2504705 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HNO12_RS11875 (HNO12_11910) sinR 2504739..2505074 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNO12_RS11880 (HNO12_11915) tasA 2505122..2505907 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  HNO12_RS11885 (HNO12_11920) sipW 2505971..2506555 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HNO12_RS11890 (HNO12_11925) tapA 2506527..2507198 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  HNO12_RS11895 (HNO12_11930) - 2507458..2507787 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  HNO12_RS11900 (HNO12_11935) - 2507827..2508006 (-) 180 WP_003153093.1 YqzE family protein -
  HNO12_RS11905 (HNO12_11940) comGG 2508063..2508440 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNO12_RS11910 (HNO12_11945) comGF 2508441..2508941 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  HNO12_RS11915 (HNO12_11950) comGE 2508850..2509164 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNO12_RS11920 (HNO12_11955) comGD 2509148..2509585 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=444471 HNO12_RS11870 WP_003153105.1 2504532..2504705(+) (sinI) [Bacillus amyloliquefaciens strain WF02]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=444471 HNO12_RS11870 WP_003153105.1 2504532..2504705(+) (sinI) [Bacillus amyloliquefaciens strain WF02]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702