Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   HNO12_RS01970 Genome accession   NZ_CP053376
Coordinates   420935..421054 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain WF02     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 415935..426054
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO12_RS01955 (HNO12_01960) - 417547..418230 (+) 684 WP_024084885.1 response regulator transcription factor -
  HNO12_RS01960 (HNO12_01965) - 418217..419650 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  HNO12_RS01965 (HNO12_01970) rapC 419803..420951 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  HNO12_RS01970 (HNO12_01975) phrC 420935..421054 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HNO12_RS01975 (HNO12_01980) - 421204..421299 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  HNO12_RS01980 (HNO12_01985) - 421394..422758 (-) 1365 WP_003156333.1 aspartate kinase -
  HNO12_RS01985 (HNO12_01990) ceuB 423173..424126 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  HNO12_RS01990 (HNO12_01995) - 424116..425063 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  HNO12_RS01995 (HNO12_02000) - 425057..425815 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=444441 HNO12_RS01970 WP_003156334.1 420935..421054(+) (phrC) [Bacillus amyloliquefaciens strain WF02]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=444441 HNO12_RS01970 WP_003156334.1 420935..421054(+) (phrC) [Bacillus amyloliquefaciens strain WF02]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718