Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilA/pilA1   Type   Machinery gene
Locus tag   SYNPCCP_RS06085 Genome accession   NC_017039
Coordinates   1296065..1296571 (-) Length   168 a.a.
NCBI ID   WP_010872381.1    Uniprot ID   -
Organism   Synechocystis sp. PCC 6803 substr. PCC-P     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1280433..1301807 1296065..1296571 within 0


Gene organization within MGE regions


Location: 1280433..1301807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SYNPCCP_RS06005 (SYNPCCP_1158) sppA 1280433..1282265 (-) 1833 WP_010872365.1 signal peptide peptidase SppA -
  SYNPCCP_RS06010 (SYNPCCP_1159) - 1282262..1282774 (-) 513 WP_010872366.1 Ycf51 family protein -
  SYNPCCP_RS06015 (SYNPCCP_1160) - 1282813..1283598 (+) 786 WP_010872367.1 alpha/beta fold hydrolase -
  SYNPCCP_RS06020 (SYNPCCP_1161) hemA 1283732..1285015 (+) 1284 WP_010872368.1 glutamyl-tRNA reductase -
  SYNPCCP_RS06025 (SYNPCCP_1162) - 1285177..1285974 (+) 798 WP_010872369.1 hypothetical protein -
  SYNPCCP_RS06030 (SYNPCCP_1163) - 1285940..1287835 (-) 1896 WP_010872370.1 ABC transporter substrate-binding protein -
  SYNPCCP_RS06035 (SYNPCCP_1164) - 1287804..1288184 (-) 381 WP_010872371.1 hypothetical protein -
  SYNPCCP_RS06040 (SYNPCCP_1165) - 1288461..1289426 (-) 966 WP_010872372.1 DUF362 domain-containing protein -
  SYNPCCP_RS06045 (SYNPCCP_1166) - 1289568..1290029 (+) 462 WP_020861674.1 DUF29 domain-containing protein -
  SYNPCCP_RS06050 (SYNPCCP_1167) - 1290152..1290628 (+) 477 WP_010872374.1 DUF29 domain-containing protein -
  SYNPCCP_RS06055 (SYNPCCP_1168) - 1290703..1291164 (+) 462 WP_010872375.1 DUF29 domain-containing protein -
  SYNPCCP_RS06060 (SYNPCCP_1169) - 1291287..1291751 (+) 465 WP_010872376.1 DUF29 domain-containing protein -
  SYNPCCP_RS06065 (SYNPCCP_1170) - 1291892..1292428 (+) 537 WP_010872377.1 methyltransferase domain-containing protein -
  SYNPCCP_RS06070 (SYNPCCP_1171) - 1292470..1294623 (+) 2154 WP_010872378.1 hypothetical protein -
  SYNPCCP_RS06075 (SYNPCCP_1172) - 1294640..1295452 (-) 813 WP_010872379.1 hypothetical protein -
  SYNPCCP_RS06080 (SYNPCCP_1173) - 1295454..1295966 (-) 513 WP_010872380.1 type IV pilin protein -
  SYNPCCP_RS06085 (SYNPCCP_1174) pilA/pilA1 1296065..1296571 (-) 507 WP_010872381.1 type IV pilin protein Machinery gene
  SYNPCCP_RS06090 (SYNPCCP_1175) - 1296715..1298037 (-) 1323 WP_010872382.1 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG -
  SYNPCCP_RS06095 (SYNPCCP_1176) - 1298192..1298797 (+) 606 WP_010872383.1 hypothetical protein -
  SYNPCCP_RS06100 (SYNPCCP_1177) - 1298801..1299238 (-) 438 WP_010872384.1 DUF29 domain-containing protein -
  SYNPCCP_RS06105 (SYNPCCP_1178) - 1299231..1299683 (-) 453 WP_010872385.1 DUF4351 domain-containing protein -
  SYNPCCP_RS06110 (SYNPCCP_1179) - 1299733..1300683 (+) 951 WP_014407173.1 pentapeptide repeat-containing protein -
  SYNPCCP_RS06115 (SYNPCCP_1180) - 1300698..1301807 (-) 1110 WP_010872387.1 RNA polymerase sigma factor, RpoD/SigA family -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 17573.69 Da        Isoelectric Point: 4.4065

>NTDB_id=44355 SYNPCCP_RS06085 WP_010872381.1 1296065..1296571(-) (pilA/pilA1) [Synechocystis sp. PCC 6803 substr. PCC-P]
MASNFKFKLLSQLSKKRAEGGFTLIELLVVVIIIGVLAAIALPNLLGQVGKARESEAKSTIGALNRAQQGYFTEKGTFAT
DTETLEVPAPDGNFFSFAVNTADNTEAIQDATALNWEADGTRSMSGGTFYDSGTRAFSTVVCRAEAGSEDTPPTPGGAND
CGGAEVIK

Nucleotide


Download         Length: 507 bp        

>NTDB_id=44355 SYNPCCP_RS06085 WP_010872381.1 1296065..1296571(-) (pilA/pilA1) [Synechocystis sp. PCC 6803 substr. PCC-P]
ATGGCTAGTAATTTTAAATTCAAACTCCTCTCTCAACTCTCCAAAAAACGGGCAGAAGGTGGTTTCACCTTAATCGAACT
GCTGGTTGTTGTAATTATTATCGGTGTATTGGCTGCTATTGCTCTGCCTAACCTCTTGGGTCAAGTTGGTAAAGCACGGG
AGTCCGAAGCTAAATCCACTATCGGTGCTTTGAACCGTGCCCAACAAGGTTATTTTACTGAGAAGGGTACGTTTGCAACC
GATACGGAAACGCTTGAAGTCCCAGCTCCTGATGGTAATTTCTTTAGTTTTGCAGTTAACACTGCTGACAACACAGAAGC
TATCCAAGACGCAACGGCATTGAATTGGGAGGCTGACGGCACCCGCTCCATGTCAGGTGGAACGTTTTACGATTCAGGCA
CCCGCGCCTTCAGTACTGTTGTTTGTCGGGCTGAAGCAGGTAGTGAAGATACTCCCCCAACCCCAGGAGGGGCTAATGAT
TGTGGTGGTGCTGAAGTAATTAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilA/pilA1 Synechocystis sp. PCC 6803

100

100

1


Multiple sequence alignment