Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   IUJ46_RS08950 Genome accession   NZ_CP064364
Coordinates   1735707..1735991 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain PartK-Spyogenes-RM8376     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1730707..1740991
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IUJ46_RS08925 (IUJ46_08880) - 1732653..1733018 (+) 366 WP_002986560.1 DUF1033 family protein -
  IUJ46_RS08930 (IUJ46_08885) comGA 1733111..1734049 (+) 939 WP_010921798.1 competence type IV pilus ATPase ComGA Machinery gene
  IUJ46_RS08935 (IUJ46_08890) comGB 1733985..1735019 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  IUJ46_RS08940 (IUJ46_08895) comGC 1735021..1735347 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  IUJ46_RS08945 (IUJ46_08900) comGD 1735322..1735750 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  IUJ46_RS08950 (IUJ46_08905) comGE 1735707..1735991 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  IUJ46_RS08955 (IUJ46_08910) comGF 1735984..1736418 (+) 435 WP_010921800.1 competence type IV pilus minor pilin ComGF Machinery gene
  IUJ46_RS08960 (IUJ46_08915) comGG 1736402..1736728 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  IUJ46_RS08965 (IUJ46_08920) comGH 1736826..1737779 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  IUJ46_RS08970 (IUJ46_08925) - 1737838..1739034 (+) 1197 WP_010921803.1 acetate kinase -
  IUJ46_RS08975 (IUJ46_08930) - 1739221..1739529 (+) 309 WP_010921804.1 hypothetical protein -
  IUJ46_RS08980 (IUJ46_08935) proC 1739612..1740382 (-) 771 WP_010921805.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=443048 IUJ46_RS08950 WP_002987779.1 1735707..1735991(+) (comGE) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=443048 IUJ46_RS08950 WP_002987779.1 1735707..1735991(+) (comGE) [Streptococcus pyogenes strain PartK-Spyogenes-RM8376]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383