Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PMCN06_RS06865 | Genome accession | NC_017027 |
| Coordinates | 1489217..1489669 (-) | Length | 150 a.a. |
| NCBI ID | WP_014391450.1 | Uniprot ID | - |
| Organism | Pasteurella multocida subsp. multocida str. HN06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1475200..1526305 | 1489217..1489669 | within | 0 |
Gene organization within MGE regions
Location: 1475200..1526305
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PMCN06_RS06795 (PMCN06_1372) | ssb | 1475200..1475700 (+) | 501 | WP_005725039.1 | single-stranded DNA-binding protein | Machinery gene |
| PMCN06_RS06800 (PMCN06_1373) | - | 1477050..1480040 (+) | 2991 | WP_228376237.1 | NACHT domain-containing protein | - |
| PMCN06_RS11850 | - | 1480101..1481219 (+) | 1119 | WP_228376238.1 | hypothetical protein | - |
| PMCN06_RS06805 (PMCN06_1376) | - | 1482001..1482381 (-) | 381 | WP_014391439.1 | hypothetical protein | - |
| PMCN06_RS06810 (PMCN06_1377) | folD | 1482397..1483251 (-) | 855 | WP_014391440.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| PMCN06_RS06825 (PMCN06_1378) | - | 1483626..1484681 (-) | 1056 | WP_014391441.1 | tyrosine-type recombinase/integrase | - |
| PMCN06_RS11595 | - | 1484585..1484887 (-) | 303 | WP_075271365.1 | helix-turn-helix domain-containing protein | - |
| PMCN06_RS06830 (PMCN06_1379) | - | 1485071..1485793 (-) | 723 | WP_014391442.1 | phage antirepressor KilAC domain-containing protein | - |
| PMCN06_RS06835 (PMCN06_1380) | - | 1485804..1486025 (-) | 222 | WP_014391443.1 | hypothetical protein | - |
| PMCN06_RS06840 (PMCN06_1381) | - | 1486284..1486640 (-) | 357 | WP_014391444.1 | hypothetical protein | - |
| PMCN06_RS06845 (PMCN06_1382) | - | 1486649..1487146 (-) | 498 | WP_014391445.1 | DUF551 domain-containing protein | - |
| PMCN06_RS06850 (PMCN06_1384) | - | 1487281..1487880 (-) | 600 | WP_014391447.1 | hypothetical protein | - |
| PMCN06_RS06855 (PMCN06_1385) | - | 1487931..1488719 (-) | 789 | WP_014391448.1 | DUF2303 family protein | - |
| PMCN06_RS06860 (PMCN06_1386) | - | 1488791..1489144 (-) | 354 | WP_014391449.1 | hypothetical protein | - |
| PMCN06_RS06865 (PMCN06_1387) | ssb | 1489217..1489669 (-) | 453 | WP_014391450.1 | single-stranded DNA-binding protein | Machinery gene |
| PMCN06_RS06870 (PMCN06_1388) | - | 1489669..1490329 (-) | 661 | Protein_1348 | translocation protein TolB precursor | - |
| PMCN06_RS06875 (PMCN06_1390) | - | 1490316..1491269 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| PMCN06_RS06880 (PMCN06_1391) | - | 1491271..1491558 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| PMCN06_RS06885 | - | 1491571..1491807 (-) | 237 | WP_041423119.1 | hypothetical protein | - |
| PMCN06_RS06890 (PMCN06_1392) | - | 1491779..1492078 (-) | 300 | WP_014391453.1 | hypothetical protein | - |
| PMCN06_RS06895 (PMCN06_1393) | - | 1492226..1492456 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| PMCN06_RS06900 (PMCN06_1394) | - | 1492518..1493126 (-) | 609 | WP_014391454.1 | Bro-N domain-containing protein | - |
| PMCN06_RS06905 (PMCN06_1395) | - | 1493506..1494039 (+) | 534 | WP_014391455.1 | hypothetical protein | - |
| PMCN06_RS06910 (PMCN06_1396) | - | 1494129..1494392 (-) | 264 | WP_014391456.1 | hypothetical protein | - |
| PMCN06_RS06915 (PMCN06_1397) | - | 1494576..1494848 (+) | 273 | WP_014391457.1 | hypothetical protein | - |
| PMCN06_RS06920 (PMCN06_1398) | - | 1494841..1495029 (-) | 189 | WP_014391458.1 | hypothetical protein | - |
| PMCN06_RS06925 (PMCN06_1399) | - | 1495326..1495520 (+) | 195 | WP_014391459.1 | hypothetical protein | - |
| PMCN06_RS11760 (PMCN06_1400) | - | 1495501..1495671 (-) | 171 | WP_014391460.1 | hypothetical protein | - |
| PMCN06_RS06930 (PMCN06_1401) | - | 1495684..1495914 (-) | 231 | WP_014391461.1 | hypothetical protein | - |
| PMCN06_RS11855 (PMCN06_1402) | - | 1496631..1496942 (-) | 312 | WP_228376240.1 | hypothetical protein | - |
| PMCN06_RS06940 (PMCN06_1403) | - | 1496914..1497309 (-) | 396 | WP_014391463.1 | hypothetical protein | - |
| PMCN06_RS06945 (PMCN06_1404) | - | 1497359..1498045 (-) | 687 | WP_014391464.1 | XRE family transcriptional regulator | - |
| PMCN06_RS06950 (PMCN06_1405) | - | 1498173..1498382 (+) | 210 | WP_014391465.1 | helix-turn-helix transcriptional regulator | - |
| PMCN06_RS06955 (PMCN06_1406) | - | 1498431..1498883 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| PMCN06_RS06960 (PMCN06_1407) | - | 1498941..1499121 (+) | 181 | Protein_1367 | hypothetical protein | - |
| PMCN06_RS11475 (PMCN06_1408) | - | 1499198..1500010 (+) | 813 | WP_014391468.1 | replication protein | - |
| PMCN06_RS06965 (PMCN06_1409) | - | 1500007..1500699 (+) | 693 | WP_014391469.1 | replication protein P | - |
| PMCN06_RS06970 (PMCN06_1410) | - | 1500703..1501239 (+) | 537 | WP_014391470.1 | phage N-6-adenine-methyltransferase | - |
| PMCN06_RS06975 (PMCN06_1411) | - | 1501229..1501687 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| PMCN06_RS06980 (PMCN06_1412) | - | 1501761..1501976 (+) | 216 | WP_014391472.1 | hypothetical protein | - |
| PMCN06_RS06985 (PMCN06_1413) | - | 1501969..1502571 (+) | 603 | WP_014391473.1 | recombination protein NinG | - |
| PMCN06_RS06990 (PMCN06_1414) | - | 1502573..1503034 (+) | 462 | WP_014391474.1 | antiterminator Q family protein | - |
| PMCN06_RS07000 (PMCN06_1415) | - | 1503361..1503621 (+) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| PMCN06_RS07005 (PMCN06_1416) | - | 1503618..1504148 (+) | 531 | WP_041423122.1 | lysozyme | - |
| PMCN06_RS11600 | - | 1504121..1504444 (+) | 324 | WP_079157976.1 | DUF2570 family protein | - |
| PMCN06_RS07015 (PMCN06_1418) | - | 1504654..1505022 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| PMCN06_RS07020 (PMCN06_1419) | - | 1505058..1505318 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| PMCN06_RS07025 (PMCN06_1420) | - | 1505608..1506081 (+) | 474 | WP_014391479.1 | DUF1441 family protein | - |
| PMCN06_RS07030 (PMCN06_1421) | - | 1506085..1508193 (+) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| PMCN06_RS07035 (PMCN06_1422) | - | 1508190..1508411 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| PMCN06_RS07040 (PMCN06_1423) | - | 1508408..1509946 (+) | 1539 | WP_041423124.1 | phage portal protein | - |
| PMCN06_RS07045 (PMCN06_1424) | - | 1509882..1511888 (+) | 2007 | WP_014391483.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| PMCN06_RS07050 (PMCN06_1425) | - | 1511960..1512286 (+) | 327 | WP_005719720.1 | DUF2190 family protein | - |
| PMCN06_RS07055 (PMCN06_1426) | - | 1512279..1512572 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| PMCN06_RS07060 (PMCN06_1427) | - | 1512572..1513123 (+) | 552 | WP_014391485.1 | phage tail protein | - |
| PMCN06_RS07065 (PMCN06_1428) | gpU | 1513120..1513527 (+) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| PMCN06_RS07070 (PMCN06_1429) | - | 1513524..1514033 (+) | 510 | WP_014391487.1 | phage tail tube protein | - |
| PMCN06_RS07075 (PMCN06_1430) | - | 1514036..1514425 (+) | 390 | WP_014391488.1 | phage minor tail protein G | - |
| PMCN06_RS07080 (PMCN06_1431) | - | 1514446..1514748 (+) | 303 | WP_228376255.1 | phage tail assembly protein T | - |
| PMCN06_RS07085 (PMCN06_1432) | - | 1514765..1517128 (+) | 2364 | WP_228376256.1 | phage tail length tape measure family protein | - |
| PMCN06_RS07090 (PMCN06_1433) | - | 1517125..1517475 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| PMCN06_RS07095 (PMCN06_1434) | - | 1517764..1518477 (+) | 714 | WP_014391492.1 | phage minor tail protein L | - |
| PMCN06_RS07100 (PMCN06_1435) | - | 1518482..1519225 (+) | 744 | WP_041423126.1 | C40 family peptidase | - |
| PMCN06_RS07105 (PMCN06_1436) | - | 1519168..1519788 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| PMCN06_RS07110 (PMCN06_1437) | - | 1519792..1524795 (+) | 5004 | WP_014391494.1 | phage tail protein | - |
| PMCN06_RS07115 (PMCN06_1438) | - | 1524843..1525166 (+) | 324 | WP_014390761.1 | hypothetical protein | - |
| PMCN06_RS07120 (PMCN06_1440) | - | 1525886..1526305 (+) | 420 | WP_005719426.1 | DUF417 family protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16941.67 Da Isoelectric Point: 5.3042
>NTDB_id=44277 PMCN06_RS06865 WP_014391450.1 1489217..1489669(-) (ssb) [Pasteurella multocida subsp. multocida str. HN06]
MAGVNKAIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQAPQNNAYANAKAGKPVQQADNFEEDNIPF
MAGVNKAIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQAPQNNAYANAKAGKPVQQADNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=44277 PMCN06_RS06865 WP_014391450.1 1489217..1489669(-) (ssb) [Pasteurella multocida subsp. multocida str. HN06]
ATGGCTGGAGTCAATAAAGCAATTATCGTGGGGAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTAGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGAATGCGAAAGCTG
GAAAGCCAGTGCAGCAAGCAGATAACTTTGAAGAGGATAATATCCCGTTCTGA
ATGGCTGGAGTCAATAAAGCAATTATCGTGGGGAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTAGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGAATGCGAAAGCTG
GAAAGCCAGTGCAGCAAGCAGATAACTTTGAAGAGGATAATATCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
65.193 |
100 |
0.787 |
| ssb | Vibrio cholerae strain A1552 |
56.164 |
97.333 |
0.547 |
| ssb | Neisseria gonorrhoeae MS11 |
46.043 |
92.667 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
46.043 |
92.667 |
0.427 |