Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   IRJ24_RS10375 Genome accession   NZ_CP064093
Coordinates   2012612..2012752 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N1282-4at     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2007612..2017752
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ24_RS10345 yueI 2007907..2008305 (+) 399 WP_003242987.1 YueI family protein -
  IRJ24_RS10350 pncA 2008402..2008953 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  IRJ24_RS10355 pncB 2008969..2010441 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ24_RS10360 pdeH 2010578..2011807 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ24_RS10365 - 2011783..2012151 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ24_RS10370 - 2012265..2012390 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ24_RS10375 degQ 2012612..2012752 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ24_RS10380 comQ 2012937..2013836 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ24_RS10385 comX 2013824..2013991 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ24_RS10390 comP 2014006..2016314 (+) 2309 Protein_1989 two-component system sensor histidine kinase ComP -
  IRJ24_RS10395 comA 2016395..2017039 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ24_RS10400 yuxO 2017058..2017438 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=441727 IRJ24_RS10375 WP_003220708.1 2012612..2012752(+) (degQ) [Bacillus subtilis strain N1282-4at]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=441727 IRJ24_RS10375 WP_003220708.1 2012612..2012752(+) (degQ) [Bacillus subtilis strain N1282-4at]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1