Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   IRJ22_RS08405 Genome accession   NZ_CP064092
Coordinates   1601674..1602111 (-) Length   145 a.a.
NCBI ID   WP_009327905.1    Uniprot ID   Q8VQ70
Organism   Bacillus licheniformis strain C5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1596674..1607111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ22_RS08355 sinI 1596843..1597019 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  IRJ22_RS08360 sinR 1597053..1597388 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  IRJ22_RS08365 tasA 1597493..1598287 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  IRJ22_RS08370 sipW 1598361..1598945 (-) 585 WP_003183449.1 signal peptidase I SipW -
  IRJ22_RS08375 tapA 1598942..1599670 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ22_RS08380 - 1599947..1600267 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  IRJ22_RS08385 - 1600297..1600479 (-) 183 WP_003183456.1 YqzE family protein -
  IRJ22_RS08390 comGG 1600568..1600933 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  IRJ22_RS08395 comGF 1600946..1601434 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  IRJ22_RS08400 comGE 1601343..1601690 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  IRJ22_RS08405 comGD 1601674..1602111 (-) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  IRJ22_RS08410 comGC 1602117..1602410 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  IRJ22_RS08415 comGB 1602424..1603458 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  IRJ22_RS08420 comGA 1603448..1604512 (-) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  IRJ22_RS08425 - 1604669..1605508 (-) 840 WP_003183480.1 STAS domain-containing protein -
  IRJ22_RS08435 - 1605750..1606127 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  IRJ22_RS08440 - 1606336..1606581 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16249.07 Da        Isoelectric Point: 9.6739

>NTDB_id=441584 IRJ22_RS08405 WP_009327905.1 1601674..1602111(-) (comGD) [Bacillus licheniformis strain C5]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=441584 IRJ22_RS08405 WP_009327905.1 1601674..1602111(-) (comGD) [Bacillus licheniformis strain C5]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8VQ70

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393