Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   HC658_RS16015 Genome accession   NZ_CP051466
Coordinates   3097947..3098087 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain UCMB5021     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3092947..3103087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC658_RS15990 (HC658_31490) yuxO 3093223..3093603 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  HC658_RS15995 (HC658_31500) comA 3093622..3094267 (-) 646 Protein_3102 two-component system response regulator ComA -
  HC658_RS16000 (HC658_31510) comP 3094348..3096660 (-) 2313 WP_032722435.1 histidine kinase Regulator
  HC658_RS16005 (HC658_31520) comX 3096676..3096897 (-) 222 WP_014480704.1 competence pheromone ComX -
  HC658_RS16010 (HC658_31530) - 3096899..3097762 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  HC658_RS16015 (HC658_31540) degQ 3097947..3098087 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HC658_RS16020 - 3098309..3098434 (+) 126 WP_003228793.1 hypothetical protein -
  HC658_RS16025 (HC658_31550) - 3098548..3098916 (+) 369 WP_014477834.1 hypothetical protein -
  HC658_RS16030 (HC658_31560) pdeH 3098892..3100121 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HC658_RS16035 (HC658_31570) pncB 3100258..3101730 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  HC658_RS16040 (HC658_31580) pncA 3101746..3102297 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  HC658_RS16045 (HC658_31590) yueI 3102394..3102792 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=438676 HC658_RS16015 WP_003220708.1 3097947..3098087(-) (degQ) [Bacillus subtilis subsp. subtilis strain UCMB5021]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=438676 HC658_RS16015 WP_003220708.1 3097947..3098087(-) (degQ) [Bacillus subtilis subsp. subtilis strain UCMB5021]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1