Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   B657_RS16835 Genome accession   NC_018520
Coordinates   3188531..3188671 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis QB928     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3183531..3193671
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B657_RS16810 (B657_31670) yuxO 3183844..3184224 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  B657_RS16815 (B657_31680) comA 3184243..3184887 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  B657_RS16820 (B657_31690) comP 3184968..3187277 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  B657_RS16825 (B657_31700) comX 3187292..3187459 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  B657_RS16830 (B657_31710) comQ 3187447..3188346 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  B657_RS16835 (B657_31720) degQ 3188531..3188671 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  B657_RS22575 - 3188893..3189018 (+) 126 WP_003228793.1 hypothetical protein -
  B657_RS16840 (B657_31730) - 3189132..3189500 (+) 369 WP_003243784.1 hypothetical protein -
  B657_RS16845 (B657_31740) pdeH 3189476..3190705 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  B657_RS16850 (B657_31750) pncB 3190842..3192314 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  B657_RS16855 (B657_31760) pncA 3192330..3192881 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  B657_RS16860 (B657_31770) yueI 3192978..3193376 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=43861 B657_RS16835 WP_003220708.1 3188531..3188671(-) (degQ) [Bacillus subtilis QB928]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=43861 B657_RS16835 WP_003220708.1 3188531..3188671(-) (degQ) [Bacillus subtilis QB928]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment