Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HC659_RS15975 Genome accession   NZ_CP051465
Coordinates   3097746..3097886 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain UCMB5121     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3092746..3102886
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC659_RS15950 (HC659_31470) yuxO 3093022..3093402 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  HC659_RS15955 (HC659_31480) comA 3093421..3094066 (-) 646 Protein_3095 two-component system response regulator ComA -
  HC659_RS15960 (HC659_31490) comP 3094147..3096459 (-) 2313 WP_032722435.1 histidine kinase Regulator
  HC659_RS15965 (HC659_31500) comX 3096475..3096696 (-) 222 WP_014480704.1 competence pheromone ComX -
  HC659_RS15970 (HC659_31510) - 3096698..3097561 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  HC659_RS15975 (HC659_31520) degQ 3097746..3097886 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  HC659_RS15980 - 3098108..3098233 (+) 126 WP_003228793.1 hypothetical protein -
  HC659_RS15985 (HC659_31530) - 3098347..3098715 (+) 369 WP_014477834.1 hypothetical protein -
  HC659_RS15990 (HC659_31540) pdeH 3098691..3099920 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  HC659_RS15995 (HC659_31550) pncB 3100057..3101529 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  HC659_RS16000 (HC659_31560) pncA 3101545..3102096 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  HC659_RS16005 (HC659_31570) yueI 3102193..3102591 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=438593 HC659_RS15975 WP_003220708.1 3097746..3097886(-) (degQ) [Bacillus subtilis subsp. subtilis strain UCMB5121]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=438593 HC659_RS15975 WP_003220708.1 3097746..3097886(-) (degQ) [Bacillus subtilis subsp. subtilis strain UCMB5121]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1