Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   B657_RS13330 Genome accession   NC_018520
Coordinates   2531950..2532123 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis QB928     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2526950..2537123
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B657_RS13315 (B657_24570) gcvT 2527749..2528837 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  B657_RS13320 (B657_24580) hepAA 2529279..2530952 (+) 1674 WP_004398544.1 SNF2-related protein -
  B657_RS13325 (B657_24590) yqhG 2530973..2531767 (+) 795 WP_003230200.1 YqhG family protein -
  B657_RS13330 (B657_24600) sinI 2531950..2532123 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B657_RS13335 (B657_24610) sinR 2532157..2532492 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B657_RS13340 (B657_24620) tasA 2532585..2533370 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  B657_RS13345 (B657_24630) sipW 2533434..2534006 (-) 573 WP_003246088.1 signal peptidase I SipW -
  B657_RS13350 (B657_24640) tapA 2533990..2534751 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  B657_RS13355 (B657_24650) yqzG 2535023..2535349 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  B657_RS13360 (B657_24660) spoIITA 2535391..2535570 (-) 180 WP_003230176.1 YqzE family protein -
  B657_RS13365 (B657_24670) comGG 2535641..2536015 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  B657_RS13370 (B657_24680) comGF 2536016..2536399 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  B657_RS13375 (B657_24690) comGE 2536425..2536772 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=43825 B657_RS13330 WP_003230187.1 2531950..2532123(+) (sinI) [Bacillus subtilis QB928]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=43825 B657_RS13330 WP_003230187.1 2531950..2532123(+) (sinI) [Bacillus subtilis QB928]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment