Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   HCM98_RS20885 Genome accession   NZ_CP051013
Coordinates   4025105..4025383 (-) Length   92 a.a.
NCBI ID   WP_029438030.1    Uniprot ID   -
Organism   Bacillus tropicus strain LM1212-DB     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3985472..4028825 4025105..4025383 within 0


Gene organization within MGE regions


Location: 3985472..4028825
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCM98_RS20585 (HCM98_20615) ftsL 3985662..3986024 (-) 363 WP_000067082.1 cell division protein FtsL -
  HCM98_RS20590 (HCM98_20620) rsmH 3986040..3986972 (-) 933 WP_029439634.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  HCM98_RS20595 (HCM98_20625) bshC 3987342..3988958 (-) 1617 WP_118991640.1 bacillithiol biosynthesis cysteine-adding enzyme BshC -
  HCM98_RS20600 (HCM98_20630) panE 3989038..3989928 (-) 891 WP_029439635.1 2-dehydropantoate 2-reductase -
  HCM98_RS20605 (HCM98_20635) - 3990223..3990696 (+) 474 WP_029439636.1 N-acetyltransferase -
  HCM98_RS20610 (HCM98_20640) - 3990730..3991236 (-) 507 WP_000246480.1 RsfA family transcriptional regulator -
  HCM98_RS20615 (HCM98_20645) rpmF 3991366..3991539 (-) 174 WP_001984764.1 50S ribosomal protein L32 -
  HCM98_RS20620 (HCM98_20650) - 3991601..3992101 (-) 501 WP_000872145.1 DUF177 domain-containing protein -
  HCM98_RS20625 (HCM98_20655) - 3992375..3992992 (-) 618 WP_118991641.1 replication-relaxation family protein -
  HCM98_RS20630 (HCM98_20660) - 3992934..3994118 (-) 1185 WP_029439637.1 FtsK/SpoIIIE domain-containing protein -
  HCM98_RS20635 (HCM98_20665) - 3994237..3994419 (-) 183 WP_029439638.1 hypothetical protein -
  HCM98_RS20640 (HCM98_20670) - 3994416..3994712 (-) 297 WP_029439639.1 hypothetical protein -
  HCM98_RS20645 (HCM98_20675) - 3994897..3995109 (+) 213 WP_001237238.1 helix-turn-helix transcriptional regulator -
  HCM98_RS20650 (HCM98_20680) - 3995102..3995593 (+) 492 WP_029439640.1 hypothetical protein -
  HCM98_RS20655 (HCM98_20685) - 3995650..3996447 (-) 798 WP_029439641.1 GH25 family lysozyme -
  HCM98_RS20660 (HCM98_20690) - 3996447..3996653 (-) 207 WP_029439642.1 hypothetical protein -
  HCM98_RS20665 (HCM98_20695) - 3996662..3996901 (-) 240 WP_000818882.1 hemolysin XhlA family protein -
  HCM98_RS20670 (HCM98_20700) - 3996992..3997324 (-) 333 WP_029439643.1 hypothetical protein -
  HCM98_RS20675 (HCM98_20705) - 3997388..3998878 (-) 1491 WP_029439644.1 hypothetical protein -
  HCM98_RS20680 (HCM98_20710) - 3998937..4000556 (-) 1620 WP_029439645.1 phage tail protein -
  HCM98_RS20685 (HCM98_20715) - 4000572..4001435 (-) 864 WP_029439646.1 phage tail family protein -
  HCM98_RS20690 (HCM98_20720) - 4001440..4005954 (-) 4515 WP_029439647.1 hypothetical protein -
  HCM98_RS32090 - 4005963..4006091 (-) 129 WP_002009224.1 hypothetical protein -
  HCM98_RS20695 (HCM98_20725) - 4006133..4006594 (-) 462 WP_029439648.1 hypothetical protein -
  HCM98_RS20700 (HCM98_20730) - 4006662..4007249 (-) 588 WP_029439649.1 hypothetical protein -
  HCM98_RS20705 (HCM98_20735) - 4007251..4007679 (-) 429 WP_029439650.1 hypothetical protein -
  HCM98_RS20710 (HCM98_20740) - 4007666..4008067 (-) 402 WP_029439651.1 hypothetical protein -
  HCM98_RS20715 (HCM98_20745) - 4008060..4008416 (-) 357 WP_098142341.1 phage head-tail adapter protein -
  HCM98_RS20720 (HCM98_20750) - 4008397..4008696 (-) 300 WP_029439653.1 phage head-tail connector protein -
  HCM98_RS20725 (HCM98_20755) - 4008706..4008945 (-) 240 WP_029439654.1 hypothetical protein -
  HCM98_RS20730 (HCM98_20760) - 4008960..4010111 (-) 1152 WP_029439655.1 phage major capsid protein -
  HCM98_RS20735 (HCM98_20765) - 4010140..4010880 (-) 741 WP_240441736.1 head maturation protease, ClpP-related -
  HCM98_RS20740 (HCM98_20770) - 4010867..4012033 (-) 1167 WP_118991642.1 phage portal protein -
  HCM98_RS20745 (HCM98_20775) - 4012048..4013730 (-) 1683 WP_029439657.1 terminase TerL endonuclease subunit -
  HCM98_RS20750 (HCM98_20780) - 4013714..4014034 (-) 321 WP_029439658.1 P27 family phage terminase small subunit -
  HCM98_RS20755 (HCM98_20785) - 4014142..4014450 (-) 309 WP_029439659.1 hypothetical protein -
  HCM98_RS20760 (HCM98_20790) - 4014453..4014722 (-) 270 WP_240441737.1 HNH endonuclease signature motif containing protein -
  HCM98_RS20765 (HCM98_20795) - 4014761..4015012 (-) 252 WP_029439661.1 hypothetical protein -
  HCM98_RS20770 (HCM98_20800) - 4015017..4015313 (-) 297 WP_029439662.1 hypothetical protein -
  HCM98_RS20775 (HCM98_20805) - 4015320..4015544 (-) 225 WP_029439663.1 hypothetical protein -
  HCM98_RS20780 (HCM98_20810) - 4015550..4015708 (-) 159 WP_158001557.1 hypothetical protein -
  HCM98_RS20785 (HCM98_20815) - 4016078..4016632 (-) 555 WP_029439664.1 hypothetical protein -
  HCM98_RS20790 (HCM98_20820) - 4016666..4016821 (-) 156 WP_162901141.1 hypothetical protein -
  HCM98_RS20795 (HCM98_20825) - 4017023..4017565 (-) 543 WP_029439665.1 tyrosine-type recombinase/integrase -
  HCM98_RS20800 (HCM98_20830) - 4017562..4018032 (-) 471 WP_029439666.1 ArpU family phage packaging/lysis transcriptional regulator -
  HCM98_RS20805 (HCM98_20835) - 4018053..4018223 (-) 171 WP_033694766.1 hypothetical protein -
  HCM98_RS20810 (HCM98_20840) - 4018519..4019712 (+) 1194 WP_029437265.1 IS110 family transposase -
  HCM98_RS20815 (HCM98_20845) - 4019898..4020080 (-) 183 WP_029439667.1 hypothetical protein -
  HCM98_RS20820 (HCM98_20850) - 4020100..4020222 (-) 123 WP_033694767.1 DUF3983 domain-containing protein -
  HCM98_RS20825 (HCM98_20855) - 4020272..4020697 (-) 426 WP_029439668.1 hypothetical protein -
  HCM98_RS20830 (HCM98_20860) - 4020733..4021041 (-) 309 WP_029439669.1 hypothetical protein -
  HCM98_RS32095 - 4021267..4021392 (-) 126 WP_276131484.1 hypothetical protein -
  HCM98_RS20835 (HCM98_20865) - 4021410..4021658 (-) 249 WP_029438025.1 helix-turn-helix transcriptional regulator -
  HCM98_RS20840 (HCM98_20870) - 4021775..4021984 (-) 210 WP_029438026.1 hypothetical protein -
  HCM98_RS20845 (HCM98_20875) - 4022010..4022189 (-) 180 WP_033694511.1 hypothetical protein -
  HCM98_RS20850 (HCM98_20880) - 4022189..4022386 (-) 198 WP_029438027.1 hypothetical protein -
  HCM98_RS20855 (HCM98_20885) - 4022424..4022717 (-) 294 WP_029438028.1 hypothetical protein -
  HCM98_RS20860 (HCM98_20890) - 4023555..4023746 (-) 192 WP_029438029.1 hypothetical protein -
  HCM98_RS20865 (HCM98_20895) - 4023788..4024270 (-) 483 WP_029437230.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  HCM98_RS20870 (HCM98_20900) - 4024290..4024541 (-) 252 WP_000109490.1 hypothetical protein -
  HCM98_RS20875 (HCM98_20905) - 4024567..4024734 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  HCM98_RS20880 (HCM98_20910) - 4024753..4025112 (-) 360 WP_001125952.1 hypothetical protein -
  HCM98_RS20885 (HCM98_20915) abrB 4025105..4025383 (-) 279 WP_029438030.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  HCM98_RS20890 (HCM98_20920) - 4025400..4025594 (-) 195 WP_029438031.1 hypothetical protein -
  HCM98_RS20895 (HCM98_20925) - 4025597..4026460 (-) 864 WP_029438032.1 ATP-binding protein -
  HCM98_RS20900 (HCM98_20930) - 4026402..4027277 (-) 876 WP_029438033.1 phage replisome organizer N-terminal domain-containing protein -
  HCM98_RS20905 (HCM98_20935) - 4027283..4027459 (-) 177 WP_033694513.1 hypothetical protein -
  HCM98_RS20910 (HCM98_20940) - 4027489..4027653 (-) 165 WP_033694514.1 hypothetical protein -
  HCM98_RS20915 (HCM98_20945) - 4027710..4027910 (-) 201 WP_000284333.1 helix-turn-helix domain-containing protein -
  HCM98_RS20920 (HCM98_20950) - 4027963..4028187 (-) 225 WP_029438034.1 helix-turn-helix transcriptional regulator -
  HCM98_RS20925 (HCM98_20955) - 4028406..4028774 (+) 369 WP_000153812.1 helix-turn-helix transcriptional regulator -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 9987.55 Da        Isoelectric Point: 6.7197

>NTDB_id=436073 HCM98_RS20885 WP_029438030.1 4025105..4025383(-) (abrB) [Bacillus tropicus strain LM1212-DB]
MKNTGVSRKVDELGRVVIPVELRRTLGIAEGTALDIHVDGENIVLRKHEKSCFVTGEVSESNMELLGGRMFLSKAGASEL
LDALEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=436073 HCM98_RS20885 WP_029438030.1 4025105..4025383(-) (abrB) [Bacillus tropicus strain LM1212-DB]
ATGAAAAATACAGGTGTTTCAAGAAAAGTAGACGAGCTAGGGCGCGTAGTAATTCCGGTAGAGTTACGCAGAACTTTGGG
GATTGCCGAAGGAACGGCATTAGACATTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCCGAATCAAACATGGAATTGTTGGGCGGTCGAATGTTTTTGAGTAAGGCGGGAGCAAGTGAGTTA
CTTGATGCTCTTGAAAAGAGTGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

98.913

0.554