Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   HEQ83_RS01935 Genome accession   NZ_CP051011
Coordinates   380320..380439 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain BY6     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 375320..385439
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HEQ83_RS01920 - 376932..377615 (+) 684 WP_014416901.1 response regulator transcription factor -
  HEQ83_RS01925 - 377602..379035 (+) 1434 WP_168237120.1 sensor histidine kinase -
  HEQ83_RS01930 rapC 379188..380336 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  HEQ83_RS01935 phrC 380320..380439 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HEQ83_RS01940 - 380589..380699 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  HEQ83_RS01945 - 380779..382143 (-) 1365 WP_014304341.1 aspartate kinase -
  HEQ83_RS01950 ceuB 382558..383511 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  HEQ83_RS01955 - 383501..384448 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  HEQ83_RS01960 - 384442..385200 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=435980 HEQ83_RS01935 WP_003156334.1 380320..380439(+) (phrC) [Bacillus velezensis strain BY6]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=435980 HEQ83_RS01935 WP_003156334.1 380320..380439(+) (phrC) [Bacillus velezensis strain BY6]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718