Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   P411_RS05915 Genome accession   NZ_CP050998
Coordinates   1048566..1049195 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli O39:NM str. F8704-2     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1027984..1065404 1048566..1049195 within 0


Gene organization within MGE regions


Location: 1027984..1065404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P411_RS05770 - 1028046..1028309 (-) 264 WP_000224233.1 hypothetical protein -
  P411_RS05775 - 1028311..1028528 (-) 218 Protein_1073 DUF4014 family protein -
  P411_RS05780 - 1028561..1028773 (-) 213 WP_000935420.1 hypothetical protein -
  P411_RS05785 - 1028824..1029180 (-) 357 WP_000403777.1 hypothetical protein -
  P411_RS05790 - 1029158..1029619 (-) 462 WP_032361660.1 sigma-E factor regulatory protein RseB domain-containing protein -
  P411_RS05795 - 1029616..1029912 (-) 297 WP_001266134.1 DUF4406 domain-containing protein -
  P411_RS05800 - 1029909..1030331 (-) 423 WP_001151137.1 DUF977 family protein -
  P411_RS05805 - 1030372..1031442 (-) 1071 WP_001262389.1 hypothetical protein -
  P411_RS05810 - 1031514..1031939 (-) 426 WP_000693949.1 toxin YdaT family protein -
  P411_RS05815 - 1031936..1032151 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  P411_RS05820 - 1032201..1032917 (+) 717 WP_000103686.1 LexA family transcriptional regulator -
  P411_RS05825 ydfA 1033190..1033342 (+) 153 WP_000379580.1 DUF1391 family protein -
  P411_RS05830 - 1033354..1033728 (+) 375 WP_000394557.1 hypothetical protein -
  P411_RS05835 dicB 1034260..1034448 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  P411_RS05840 ydfD 1034445..1034636 (+) 192 WP_001090200.1 DUF1482 family protein -
  P411_RS05845 - 1034729..1037200 (+) 2472 WP_064482952.1 exonuclease -
  P411_RS05850 - 1037268..1037510 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  P411_RS05855 - 1037488..1038507 (+) 1020 WP_001299701.1 tyrosine-type recombinase/integrase -
  P411_RS05860 yccA 1038916..1039575 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  P411_RS05865 tusE 1039666..1039995 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  P411_RS05870 yccX 1039992..1040269 (-) 278 Protein_1092 acylphosphatase -
  P411_RS05875 rlmI 1040364..1041554 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  P411_RS05880 hspQ 1041612..1041929 (+) 318 WP_001299702.1 heat shock protein HspQ -
  P411_RS05885 yccU 1041974..1042387 (-) 414 WP_001299688.1 CoA-binding protein -
  P411_RS05890 csgI 1042560..1043222 (+) 663 WP_000847791.1 DUF2057 family protein -
  P411_RS05895 mgsA 1043318..1043776 (+) 459 WP_000424181.1 methylglyoxal synthase -
  P411_RS05900 helD 1043808..1045862 (-) 2055 WP_032361308.1 DNA helicase IV -
  P411_RS05905 yccF 1045985..1046431 (+) 447 WP_001261235.1 YccF domain-containing protein -
  P411_RS05910 yccS 1046441..1048603 (+) 2163 WP_000875015.1 YccS family putative transporter -
  P411_RS05915 sxy/tfoX 1048566..1049195 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  P411_RS05920 sulA 1049414..1049923 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  P411_RS05925 ompA 1050280..1051320 (+) 1041 WP_000750416.1 porin OmpA -
  P411_RS05930 matP 1051396..1051848 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  P411_RS05935 ycbZ 1052034..1053794 (+) 1761 WP_000156526.1 Lon protease family protein -
  P411_RS05940 fabA 1053863..1054381 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  P411_RS05945 rmf 1054451..1054618 (-) 168 WP_000828648.1 ribosome modulation factor -
  P411_RS05950 pqiC 1054874..1055437 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  P411_RS05955 pqiB 1055434..1057074 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  P411_RS05960 pqiA 1057079..1058332 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  P411_RS05965 uup 1058462..1060369 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  P411_RS05970 rlmKL 1060380..1062488 (-) 2109 WP_032361309.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  P411_RS05975 ycbX 1062732..1063841 (+) 1110 WP_000258204.1 6-N-hydroxylaminopurine resistance protein YcbX -
  P411_RS05980 zapC 1063838..1064380 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=435829 P411_RS05915 WP_000839153.1 1048566..1049195(-) (sxy/tfoX) [Escherichia coli O39:NM str. F8704-2]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=435829 P411_RS05915 WP_000839153.1 1048566..1049195(-) (sxy/tfoX) [Escherichia coli O39:NM str. F8704-2]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1