Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   SMUGS5_RS01935 Genome accession   NC_018089
Coordinates   386805..387035 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans GS-5     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 381805..392035
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMUGS5_RS01915 (SMUGS5_01820) rnpM 382379..382675 (+) 297 WP_002263922.1 RNase P modulator RnpM -
  SMUGS5_RS01920 (SMUGS5_01825) - 382668..382970 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  SMUGS5_RS10815 - 382991..383086 (+) 96 Protein_353 translation initiation factor IF-2 N-terminal domain-containing protein -
  SMUGS5_RS01925 (SMUGS5_01830) infB 383519..385741 (+) 2223 Protein_354 translation initiation factor IF-2 -
  SMUGS5_RS01930 (SMUGS5_01835) rbfA 385975..386325 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  SMUGS5_RS10720 - 386403..386537 (-) 135 WP_002267544.1 hypothetical protein -
  SMUGS5_RS01935 (SMUGS5_01840) cipB 386805..387035 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  SMUGS5_RS01940 (SMUGS5_01845) - 387426..387869 (+) 444 WP_014834855.1 CopY/TcrY family copper transport repressor -
  SMUGS5_RS01945 (SMUGS5_01850) - 387866..390094 (+) 2229 WP_002267008.1 heavy metal translocating P-type ATPase -
  SMUGS5_RS01950 (SMUGS5_01855) copZ 390107..390310 (+) 204 WP_002264873.1 copper chaperone CopZ -
  SMUGS5_RS01955 (SMUGS5_01860) - 390556..391377 (+) 822 WP_032506485.1 Cof-type HAD-IIB family hydrolase -
  SMUGS5_RS01960 (SMUGS5_01865) - 391483..391974 (-) 492 WP_042899548.1 YgjV family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=43492 SMUGS5_RS01935 WP_002275977.1 386805..387035(+) (cipB) [Streptococcus mutans GS-5]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=43492 SMUGS5_RS01935 WP_002275977.1 386805..387035(+) (cipB) [Streptococcus mutans GS-5]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395


Multiple sequence alignment