Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HCU65_RS12740 Genome accession   NZ_CP050705
Coordinates   2586877..2587050 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain PENSV20     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2581877..2592050
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCU65_RS12725 (HCU65_12755) gcvT 2582646..2583740 (-) 1095 WP_003325445.1 glycine cleavage system aminomethyltransferase GcvT -
  HCU65_RS12730 (HCU65_12760) - 2584201..2585871 (+) 1671 WP_061670006.1 DEAD/DEAH box helicase -
  HCU65_RS12735 (HCU65_12765) - 2585892..2586686 (+) 795 WP_003325443.1 YqhG family protein -
  HCU65_RS12740 (HCU65_12770) sinI 2586877..2587050 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  HCU65_RS12745 (HCU65_12775) sinR 2587084..2587419 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HCU65_RS12750 (HCU65_12780) tasA 2587612..2588394 (-) 783 WP_003325439.1 biofilm matrix protein TasA -
  HCU65_RS12755 (HCU65_12785) sipW 2588458..2589030 (-) 573 WP_010789195.1 signal peptidase I SipW -
  HCU65_RS12760 (HCU65_12790) tapA 2589014..2589715 (-) 702 WP_219946339.1 amyloid fiber anchoring/assembly protein TapA -
  HCU65_RS12765 (HCU65_12795) - 2589977..2590300 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  HCU65_RS12770 (HCU65_12800) - 2590347..2590526 (-) 180 WP_003325435.1 YqzE family protein -
  HCU65_RS12775 (HCU65_12805) comGG 2590596..2590970 (-) 375 WP_219946340.1 competence type IV pilus minor pilin ComGG Machinery gene
  HCU65_RS12780 (HCU65_12810) comGF 2590971..2591477 (-) 507 WP_309143169.1 competence type IV pilus minor pilin ComGF -
  HCU65_RS12785 (HCU65_12815) comGE 2591380..2591727 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=434125 HCU65_RS12740 WP_003325442.1 2586877..2587050(+) (sinI) [Bacillus atrophaeus strain PENSV20]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=434125 HCU65_RS12740 WP_003325442.1 2586877..2587050(+) (sinI) [Bacillus atrophaeus strain PENSV20]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789