Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   HCN55_RS13850 Genome accession   NZ_CP050532
Coordinates   2645689..2646099 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis subsp. subtilis str. SMY     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2646295..2696408 2645689..2646099 flank 196


Gene organization within MGE regions


Location: 2645689..2696408
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCN55_RS13850 (HCN55_13855) nucA/comI 2645689..2646099 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  HCN55_RS13855 (HCN55_13860) - 2646295..2646642 (+) 348 Protein_2692 sigma-70 family RNA polymerase sigma factor -
  HCN55_RS13860 (HCN55_13865) spoIVCA 2646673..2648133 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  HCN55_RS22135 - 2648091..2648269 (-) 179 Protein_2694 hypothetical protein -
  HCN55_RS13865 (HCN55_13870) arsC 2648624..2649043 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  HCN55_RS13870 (HCN55_13875) acr3 2649055..2650095 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  HCN55_RS13875 (HCN55_13880) arsK 2650118..2650558 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  HCN55_RS13880 (HCN55_13885) arsR 2650619..2650936 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  HCN55_RS13885 (HCN55_13890) yqcI 2651308..2652072 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  HCN55_RS13890 (HCN55_13895) rapE 2652515..2653642 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  HCN55_RS13895 (HCN55_13900) phrE 2653632..2653766 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  HCN55_RS13900 (HCN55_13905) - 2653876..2654034 (+) 159 WP_003245945.1 hypothetical protein -
  HCN55_RS13905 (HCN55_13910) yqcG 2654404..2655999 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  HCN55_RS13910 (HCN55_13915) yqcF 2656014..2656592 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  HCN55_RS13915 (HCN55_13920) - 2656710..2656856 (+) 147 WP_009967791.1 hypothetical protein -
  HCN55_RS13920 (HCN55_13925) - 2656853..2657215 (-) 363 WP_003229947.1 hypothetical protein -
  HCN55_RS13925 (HCN55_13930) - 2657231..2657710 (-) 480 WP_004399085.1 hypothetical protein -
  HCN55_RS13930 (HCN55_13935) cwlA 2657875..2658693 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  HCN55_RS13935 (HCN55_13940) skhD 2658738..2659160 (-) 423 WP_003246208.1 holin family protein -
  HCN55_RS13940 (HCN55_13945) xepAK 2659205..2660098 (-) 894 WP_003246010.1 hypothetical protein -
  HCN55_RS13945 (HCN55_13950) yqcE 2660186..2660350 (-) 165 WP_003229944.1 XkdX family protein -
  HCN55_RS13950 (HCN55_13955) yqcD 2660347..2660682 (-) 336 WP_009967793.1 XkdW family protein -
  HCN55_RS13955 (HCN55_13960) yqcC 2660692..2661792 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  HCN55_RS13960 (HCN55_13965) - 2661795..2662067 (-) 273 WP_003229942.1 hypothetical protein -
  HCN55_RS13965 (HCN55_13970) yqcA 2662064..2662642 (-) 579 WP_003229941.1 YmfQ family protein -
  HCN55_RS13970 (HCN55_13975) yqbT 2662626..2663672 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  HCN55_RS13975 (HCN55_13980) yqbS 2663665..2664090 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  HCN55_RS13980 (HCN55_13985) yqbR 2664103..2664366 (-) 264 WP_003229938.1 DUF2577 family protein -
  HCN55_RS13985 (HCN55_13990) yqbQ 2664363..2665343 (-) 981 WP_004398524.1 hypothetical protein -
  HCN55_RS13990 (HCN55_13995) yqbP 2665356..2666015 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  HCN55_RS13995 (HCN55_14000) yqbO 2666008..2670765 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  HCN55_RS14000 (HCN55_14005) - 2670768..2670905 (-) 138 WP_003229934.1 hypothetical protein -
  HCN55_RS14005 (HCN55_14010) - 2670947..2671396 (-) 450 WP_003229933.1 phage portal protein -
  HCN55_RS14010 (HCN55_14015) txpA 2671543..2671723 (+) 181 Protein_2724 type I toxin-antitoxin system toxin TxpA -
  HCN55_RS14015 (HCN55_14020) bsrH 2672103..2672192 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  HCN55_RS14020 (HCN55_14025) yqbM 2672446..2672889 (-) 444 WP_003229930.1 phage tail tube protein -
  HCN55_RS14025 (HCN55_14030) yqbK 2672892..2674292 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  HCN55_RS14030 (HCN55_14035) - 2674293..2674484 (-) 192 WP_010886574.1 hypothetical protein -
  HCN55_RS14035 (HCN55_14040) yqbJ 2674481..2674918 (-) 438 WP_003229927.1 DUF6838 family protein -
  HCN55_RS14040 (HCN55_14045) yqbI 2674931..2675434 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  HCN55_RS14045 (HCN55_14050) yqbH 2675431..2675793 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  HCN55_RS14050 (HCN55_14055) gkpG 2675790..2676185 (-) 396 WP_004398566.1 DUF3199 family protein -
  HCN55_RS14055 (HCN55_14060) yqbF 2676189..2676500 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  HCN55_RS14060 (HCN55_14065) skdG 2676511..2677446 (-) 936 WP_003229922.1 phage major capsid protein -
  HCN55_RS14065 (HCN55_14070) yqbD 2677465..2678433 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  HCN55_RS14070 (HCN55_14075) - 2678466..2679119 (-) 654 WP_003229920.1 hypothetical protein -
  HCN55_RS14075 (HCN55_14080) yqbB 2679160..2680077 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  HCN55_RS14080 (HCN55_14085) yqbA 2680074..2681606 (-) 1533 WP_004398894.1 phage portal protein -
  HCN55_RS14085 (HCN55_14090) stmB 2681610..2682905 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  HCN55_RS14090 (HCN55_14095) terS 2682898..2683617 (-) 720 WP_003229916.1 phage terminase small subunit -
  HCN55_RS14095 (HCN55_14100) - 2683685..2684149 (-) 465 WP_004398685.1 hypothetical protein -
  HCN55_RS14100 (HCN55_14105) yqaQ 2684293..2684748 (-) 456 WP_004398775.1 hypothetical protein -
  HCN55_RS14105 (HCN55_14110) - 2684946..2685875 (+) 930 WP_003229913.1 hypothetical protein -
  HCN55_RS14110 (HCN55_14115) yqaO 2685949..2686155 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  HCN55_RS14115 (HCN55_14120) yqaN 2686237..2686665 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  HCN55_RS14120 (HCN55_14125) - 2686761..2686910 (-) 150 WP_003229910.1 hypothetical protein -
  HCN55_RS14125 (HCN55_14130) sknM 2686901..2687842 (-) 942 WP_075058863.1 ATP-binding protein -
  HCN55_RS14130 (HCN55_14135) yqaL 2687724..2688401 (-) 678 WP_010886575.1 DnaD domain protein -
  HCN55_RS14135 (HCN55_14140) recT 2688477..2689331 (-) 855 WP_003229907.1 recombinase RecT -
  HCN55_RS14140 (HCN55_14145) yqaJ 2689334..2690293 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  HCN55_RS14145 (HCN55_14150) - 2690399..2690593 (-) 195 WP_003229905.1 hypothetical protein -
  HCN55_RS14150 (HCN55_14155) - 2690553..2690726 (-) 174 WP_119123069.1 hypothetical protein -
  HCN55_RS14155 (HCN55_14160) sknH 2690723..2690980 (-) 258 WP_003245994.1 YqaH family protein -
  HCN55_RS14160 (HCN55_14165) yqaG 2690977..2691546 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  HCN55_RS14165 (HCN55_14170) - 2691620..2691760 (-) 141 WP_003229902.1 hypothetical protein -
  HCN55_RS14170 (HCN55_14175) yqaF 2691790..2692020 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  HCN55_RS14175 (HCN55_14180) sknR 2692197..2692547 (+) 351 WP_004398704.1 transcriptional regulator SknR -
  HCN55_RS14180 (HCN55_14185) - 2692814..2692981 (-) 168 WP_003229900.1 hypothetical protein -
  HCN55_RS14185 (HCN55_14190) yqaC 2693337..2693873 (-) 537 WP_004399117.1 AAA family ATPase -
  HCN55_RS14190 (HCN55_14195) yqaB 2694142..2694660 (+) 519 WP_004399097.1 ImmA/IrrE family metallo-endopeptidase -
  HCN55_RS14195 (HCN55_14200) - 2694666..2695058 (+) 393 Protein_2761 sigma-70 family RNA polymerase sigma factor -
  HCN55_RS14200 (HCN55_14205) - 2695058..2695174 (+) 117 WP_003229898.1 hypothetical protein -
  HCN55_RS14205 (HCN55_14210) - 2695140..2695340 (-) 201 Protein_2763 recombinase family protein -
  HCN55_RS14210 (HCN55_14215) - 2695283..2695447 (-) 165 WP_010886576.1 hypothetical protein -
  HCN55_RS14215 (HCN55_14220) psiE 2695992..2696408 (-) 417 WP_003246154.1 phosphate-starvation-inducible protein PsiE -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=433757 HCN55_RS13850 WP_009967785.1 2645689..2646099(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. SMY]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=433757 HCN55_RS13850 WP_009967785.1 2645689..2646099(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. SMY]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529