Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | HB674_RS14685 | Genome accession | NZ_CP050448 |
| Coordinates | 2998578..2998718 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain BIM B-1312D | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993578..3003718
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HB674_RS14660 (HB674_14660) | - | 2993924..2994307 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| HB674_RS14665 (HB674_14665) | comA | 2994329..2994973 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| HB674_RS14670 (HB674_14670) | comP | 2995054..2997354 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| HB674_RS14675 (HB674_14675) | comX | 2997368..2997541 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| HB674_RS14680 (HB674_14680) | - | 2997510..2998370 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| HB674_RS14685 (HB674_14685) | degQ | 2998578..2998718 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| HB674_RS14695 (HB674_14695) | - | 2999184..2999525 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| HB674_RS14700 (HB674_14700) | - | 2999532..3000755 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| HB674_RS14705 (HB674_14705) | - | 3000885..3002351 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| HB674_RS14710 (HB674_14710) | - | 3002369..3002920 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| HB674_RS14715 (HB674_14715) | - | 3003017..3003415 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=432804 HB674_RS14685 WP_003152043.1 2998578..2998718(-) (degQ) [Bacillus velezensis strain BIM B-1312D]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=432804 HB674_RS14685 WP_003152043.1 2998578..2998718(-) (degQ) [Bacillus velezensis strain BIM B-1312D]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |