Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   HB674_RS02010 Genome accession   NZ_CP050448
Coordinates   398423..398542 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain BIM B-1312D     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 393423..403542
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB674_RS01995 (HB674_01995) - 395035..395718 (+) 684 WP_032872879.1 response regulator transcription factor -
  HB674_RS02000 (HB674_02000) - 395705..397138 (+) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  HB674_RS02005 (HB674_02005) rapC 397291..398439 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  HB674_RS02010 (HB674_02010) phrC 398423..398542 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HB674_RS02015 (HB674_02015) - 398693..398788 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  HB674_RS02020 (HB674_02020) - 398883..400247 (-) 1365 WP_007609394.1 aspartate kinase -
  HB674_RS02025 (HB674_02025) ceuB 400661..401614 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  HB674_RS02030 (HB674_02030) - 401604..402551 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  HB674_RS02035 (HB674_02035) - 402545..403303 (+) 759 WP_007609404.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=432752 HB674_RS02010 WP_003156334.1 398423..398542(+) (phrC) [Bacillus velezensis strain BIM B-1312D]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=432752 HB674_RS02010 WP_003156334.1 398423..398542(+) (phrC) [Bacillus velezensis strain BIM B-1312D]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718