Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   IHV08_RS16605 Genome accession   NZ_CP062497
Coordinates   3179415..3179555 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain CV16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3174415..3184555
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IHV08_RS16580 (IHV08_16580) yuxO 3174765..3175145 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  IHV08_RS16585 (IHV08_16585) comA 3175164..3175808 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IHV08_RS16590 (IHV08_16590) comP 3175889..3178186 (-) 2298 WP_033884760.1 histidine kinase Regulator
  IHV08_RS16595 (IHV08_16595) comX 3178194..3178355 (-) 162 WP_003241045.1 competence pheromone ComX -
  IHV08_RS16600 (IHV08_16600) comQ 3178370..3179230 (-) 861 WP_192857944.1 polyprenyl synthetase family protein Regulator
  IHV08_RS16605 (IHV08_16605) degQ 3179415..3179555 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IHV08_RS21885 - 3179777..3179839 (+) 63 Protein_3229 hypothetical protein -
  IHV08_RS16610 (IHV08_16610) - 3180018..3180386 (+) 369 WP_017695529.1 hypothetical protein -
  IHV08_RS16615 (IHV08_16615) pdeH 3180362..3181591 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IHV08_RS16620 (IHV08_16620) pncB 3181728..3183200 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IHV08_RS16625 (IHV08_16625) pncA 3183216..3183767 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  IHV08_RS16630 (IHV08_16630) yueI 3183864..3184262 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=431483 IHV08_RS16605 WP_003220708.1 3179415..3179555(-) (degQ) [Bacillus subtilis strain CV16]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=431483 IHV08_RS16605 WP_003220708.1 3179415..3179555(-) (degQ) [Bacillus subtilis strain CV16]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1