Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   HB751_RS09335 Genome accession   NZ_CP050272
Coordinates   1907700..1907930 (+) Length   76 a.a.
NCBI ID   WP_002309764.1    Uniprot ID   -
Organism   Streptococcus mutans strain P6     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1902700..1912930
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB751_RS09310 (HB751_09310) - 1903293..1903919 (+) 627 WP_002273094.1 hypothetical protein -
  HB751_RS09315 (HB751_09315) - 1903967..1904605 (+) 639 WP_002271525.1 VTT domain-containing protein -
  HB751_RS09320 (HB751_09320) comE/blpR 1905075..1905827 (+) 753 WP_002298154.1 response regulator transcription factor Regulator
  HB751_RS09325 (HB751_09325) - 1905824..1907150 (+) 1327 Protein_1807 sensor histidine kinase -
  HB751_RS09330 (HB751_09330) comC/blpC 1907292..1907432 (-) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  HB751_RS09335 (HB751_09335) cipB 1907700..1907930 (+) 231 WP_002309764.1 Blp family class II bacteriocin Regulator
  HB751_RS09340 (HB751_09340) - 1908061..1908462 (+) 402 WP_002310604.1 hypothetical protein -
  HB751_RS09345 (HB751_09345) - 1909842..1910261 (+) 420 WP_019804903.1 hypothetical protein -
  HB751_RS09350 (HB751_09350) - 1910408..1910812 (+) 405 WP_002263912.1 hypothetical protein -
  HB751_RS10420 - 1910935..1911147 (-) 213 Protein_1813 IS3 family transposase -
  HB751_RS09355 (HB751_09355) - 1911587..1911751 (+) 165 WP_002265308.1 hypothetical protein -
  HB751_RS09360 (HB751_09360) - 1912156..1912368 (+) 213 WP_002309424.1 Blp family class II bacteriocin -
  HB751_RS09365 (HB751_09365) - 1912533..1912722 (+) 190 Protein_1816 Blp family class II bacteriocin -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7258.07 Da        Isoelectric Point: 3.7781

>NTDB_id=431220 HB751_RS09335 WP_002309764.1 1907700..1907930(+) (cipB) [Streptococcus mutans strain P6]
MNTQAFEQFNVIDNEALSAIEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=431220 HB751_RS09335 WP_002309764.1 1907700..1907930(+) (cipB) [Streptococcus mutans strain P6]
ATGAATACACAAGCATTTGAACAATTTAACGTAATAGATAATGAAGCACTTTCAGCTATTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

97.368

100

0.974