Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/blpC   Type   Regulator
Locus tag   HB752_RS00465 Genome accession   NZ_CP050271
Coordinates   96015..96155 (-) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain S1     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 91015..101155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HB752_RS00445 (HB752_00445) - 92015..92641 (+) 627 WP_002273094.1 hypothetical protein -
  HB752_RS00450 (HB752_00450) - 92689..93327 (+) 639 WP_002271525.1 VTT domain-containing protein -
  HB752_RS00455 (HB752_00455) comE/blpR 93798..94550 (+) 753 WP_002298154.1 response regulator transcription factor Regulator
  HB752_RS00460 (HB752_00460) - 94547..95873 (+) 1327 Protein_88 GHKL domain-containing protein -
  HB752_RS00465 (HB752_00465) comC/blpC 96015..96155 (-) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  HB752_RS00470 (HB752_00470) cipB 96423..96653 (+) 231 WP_002309764.1 Blp family class II bacteriocin Regulator
  HB752_RS00475 (HB752_00475) - 96784..97185 (+) 402 WP_002310604.1 hypothetical protein -
  HB752_RS00480 (HB752_00480) - 98565..98984 (+) 420 WP_019804903.1 hypothetical protein -
  HB752_RS00485 (HB752_00485) - 99131..99535 (+) 405 WP_002263912.1 hypothetical protein -
  HB752_RS10290 - 99658..99870 (-) 213 Protein_94 IS3 family transposase -
  HB752_RS00490 (HB752_00490) - 100310..100474 (+) 165 WP_002265308.1 hypothetical protein -
  HB752_RS00495 (HB752_00495) - 100879..101091 (+) 213 WP_002309424.1 Blp family class II bacteriocin -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=431099 HB752_RS00465 WP_002270250.1 96015..96155(-) (comC/blpC) [Streptococcus mutans strain S1]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=431099 HB752_RS00465 WP_002270250.1 96015..96155(-) (comC/blpC) [Streptococcus mutans strain S1]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGTGG
AAGCCTGTCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains

Predicted by InterproScan.

COMC family (ComC)

(1-32)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978