Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   HA248_RS02825 Genome accession   NZ_CP050175
Coordinates   544345..544611 (+) Length   88 a.a.
NCBI ID   WP_001844589.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900701590     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 524827..543517 544345..544611 flank 828
IScluster/Tn 543772..544267 544345..544611 flank 78


Gene organization within MGE regions


Location: 524827..544611
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HA248_RS02745 (HA248_02735) - 525055..526449 (+) 1395 WP_033707999.1 ATP-dependent endonuclease -
  HA248_RS02750 (HA248_02740) - 526451..526660 (+) 210 WP_050249033.1 hypothetical protein -
  HA248_RS11800 (HA248_02745) - 526697..526822 (+) 126 Protein_540 DNA (cytosine-5-)-methyltransferase -
  HA248_RS02760 (HA248_02750) - 527040..527843 (+) 804 WP_001183270.1 Fic/DOC family protein -
  HA248_RS02765 (HA248_02755) - 528340..530898 (+) 2559 WP_000442369.1 DEAD/DEAH box helicase family protein -
  HA248_RS02770 (HA248_02760) licT 531198..532037 (+) 840 WP_166735668.1 BglG family transcription antiterminator LicT -
  HA248_RS02775 (HA248_02765) - 532055..533893 (+) 1839 WP_166735669.1 beta-glucoside-specific PTS transporter subunit IIABC -
  HA248_RS02780 (HA248_02770) - 533906..535321 (+) 1416 WP_033707988.1 glycoside hydrolase family 1 protein -
  HA248_RS02785 (HA248_02775) pheS 535804..536850 (+) 1047 WP_001836415.1 phenylalanine--tRNA ligase subunit alpha -
  HA248_RS02790 (HA248_02780) - 536850..537359 (+) 510 WP_000619941.1 N-acetyltransferase -
  HA248_RS02795 (HA248_02785) pheT 537436..539841 (+) 2406 WP_033707986.1 phenylalanine--tRNA ligase subunit beta -
  HA248_RS02800 (HA248_02790) - 539909..540913 (-) 1005 WP_016398280.1 endonuclease/exonuclease/phosphatase family protein -
  HA248_RS02805 (HA248_02795) - 540934..541617 (-) 684 WP_000743644.1 hypothetical protein -
  HA248_RS02810 (HA248_02800) - 541889..542398 (-) 510 WP_001066470.1 hypothetical protein -
  HA248_RS02815 (HA248_02805) - 542636..543517 (+) 882 WP_001267157.1 helix-turn-helix transcriptional regulator -
  HA248_RS02820 (HA248_02810) - 543772..544261 (+) 490 Protein_553 transposase -
  HA248_RS02825 (HA248_02815) HI0659 544345..544611 (+) 267 WP_001844589.1 helix-turn-helix domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9629.24 Da        Isoelectric Point: 5.1633

>NTDB_id=430526 HA248_RS02825 WP_001844589.1 544345..544611(+) (HI0659) [Streptococcus pneumoniae strain PZ900701590]
MEGCPSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVLASLGKILAV
VRLEQGKS

Nucleotide


Download         Length: 267 bp        

>NTDB_id=430526 HA248_RS02825 WP_001844589.1 544345..544611(+) (HI0659) [Streptococcus pneumoniae strain PZ900701590]
TTGGAAGGATGTCCATCTGAGCTCTTTAGCAAGGAGGAAATCCTTGAAAGTGATATGCGAGTAGCTATCATGAGCGAGTT
GATTGAAGCCAGAAATAAGCAAGGAATCAGTCAGAAAAAGCTAGAGGAACTCAGTGGAGTGAGTCAGCCTGTTATAGCTA
GGATGGAGACAGGTAAGACTAGTCCACAGTTGGACACAGTCTTAAAAGTCCTAGCTAGTCTAGGAAAGATACTAGCAGTC
GTCCGACTTGAACAGGGGAAAAGTTGA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(28-75)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

59.74

87.5

0.523