Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   BHV55_RS06850 Genome accession   NZ_CP049978
Coordinates   1330478..1330801 (-) Length   107 a.a.
NCBI ID   WP_000578885.1    Uniprot ID   A0A9W5VG71
Organism   Bacillus sp. RZ2MS9     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1303429..1336510 1330478..1330801 within 0


Gene organization within MGE regions


Location: 1303429..1336510
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BHV55_RS06675 (BHV55_06675) - 1303429..1303638 (+) 210 WP_000428506.1 helix-turn-helix transcriptional regulator -
  BHV55_RS06680 (BHV55_06680) - 1303641..1304018 (+) 378 WP_001109895.1 hypothetical protein -
  BHV55_RS06685 (BHV55_06685) - 1304047..1304229 (+) 183 WP_001178294.1 DUF3976 domain-containing protein -
  BHV55_RS06690 (BHV55_06690) - 1304362..1304721 (+) 360 WP_070757194.1 hypothetical protein -
  BHV55_RS06695 (BHV55_06695) - 1304844..1305764 (+) 921 WP_083320159.1 HNH endonuclease -
  BHV55_RS06700 (BHV55_06700) - 1305947..1306999 (+) 1053 WP_070757193.1 hypothetical protein -
  BHV55_RS06705 (BHV55_06705) - 1307811..1309109 (-) 1299 WP_070757192.1 hypothetical protein -
  BHV55_RS06710 (BHV55_06710) - 1309286..1310014 (+) 729 WP_070757191.1 hypothetical protein -
  BHV55_RS06715 (BHV55_06715) - 1310293..1310469 (-) 177 WP_168369335.1 hypothetical protein -
  BHV55_RS06720 (BHV55_06720) - 1310491..1310697 (-) 207 WP_070757190.1 hypothetical protein -
  BHV55_RS27655 - 1311152..1311277 (-) 126 WP_277998029.1 hypothetical protein -
  BHV55_RS06725 (BHV55_06725) - 1311339..1311542 (-) 204 WP_070757189.1 hypothetical protein -
  BHV55_RS06730 (BHV55_06730) - 1311726..1311974 (-) 249 WP_070757188.1 hypothetical protein -
  BHV55_RS06735 (BHV55_06735) - 1312046..1312216 (-) 171 WP_168369336.1 hypothetical protein -
  BHV55_RS06740 (BHV55_06740) - 1312356..1312595 (-) 240 WP_070757375.1 hypothetical protein -
  BHV55_RS06745 (BHV55_06745) - 1312739..1314064 (-) 1326 WP_070757186.1 hypothetical protein -
  BHV55_RS06750 (BHV55_06750) - 1314698..1315024 (+) 327 WP_139147410.1 hypothetical protein -
  BHV55_RS06755 (BHV55_06755) - 1315021..1315368 (+) 348 WP_070757184.1 hypothetical protein -
  BHV55_RS06760 (BHV55_06760) - 1315416..1315760 (+) 345 WP_070757183.1 HNH endonuclease -
  BHV55_RS06765 (BHV55_06765) - 1315900..1316340 (+) 441 WP_070757182.1 phage terminase small subunit P27 family -
  BHV55_RS06770 (BHV55_06770) - 1316337..1316621 (+) 285 WP_070757181.1 hypothetical protein -
  BHV55_RS06775 (BHV55_06775) - 1316798..1317034 (+) 237 WP_070757180.1 hypothetical protein -
  BHV55_RS06780 (BHV55_06780) - 1317312..1318604 (+) 1293 WP_070757179.1 phage portal protein -
  BHV55_RS06785 (BHV55_06785) - 1318597..1320324 (+) 1728 WP_083320158.1 phage major capsid protein -
  BHV55_RS06790 (BHV55_06790) - 1320683..1321177 (-) 495 WP_070757178.1 hypothetical protein -
  BHV55_RS06795 (BHV55_06795) - 1321316..1322053 (-) 738 WP_246874073.1 hypothetical protein -
  BHV55_RS06800 (BHV55_06800) - 1322176..1323261 (-) 1086 WP_246874074.1 tyrosine-type recombinase/integrase -
  BHV55_RS06810 (BHV55_06810) - 1323725..1324189 (-) 465 WP_048568803.1 hypothetical protein -
  BHV55_RS06815 (BHV55_06815) - 1324779..1325000 (-) 222 WP_000196288.1 hypothetical protein -
  BHV55_RS06820 (BHV55_06820) - 1325408..1325635 (+) 228 WP_000251856.1 hypothetical protein -
  BHV55_RS06825 (BHV55_06825) - 1325787..1327073 (+) 1287 WP_000247031.1 D-alanyl-D-alanine carboxypeptidase family protein -
  BHV55_RS06830 (BHV55_06830) - 1327264..1327833 (+) 570 WP_000767792.1 signal peptidase I -
  BHV55_RS06835 (BHV55_06835) - 1327894..1328481 (+) 588 WP_000172854.1 CalY family protein -
  BHV55_RS06840 (BHV55_06840) - 1328616..1329422 (+) 807 WP_070757175.1 DUF4047 domain-containing protein -
  BHV55_RS06845 (BHV55_06845) calY 1329810..1330403 (+) 594 WP_000053713.1 biofilm matrix protein CalY -
  BHV55_RS06850 (BHV55_06850) sinR 1330478..1330801 (-) 324 WP_000578885.1 helix-turn-helix domain-containing protein Regulator
  BHV55_RS06855 (BHV55_06855) - 1330881..1331015 (-) 135 WP_000276219.1 anti-repressor SinI family protein -
  BHV55_RS06860 (BHV55_06860) inhA1 1331358..1333748 (+) 2391 WP_001035943.1 M6 family metalloprotease immune inhibitor InhA1 -
  BHV55_RS06865 (BHV55_06865) - 1333920..1335287 (+) 1368 WP_000028382.1 aldehyde dehydrogenase -
  BHV55_RS06870 (BHV55_06870) potA 1335527..1336510 (+) 984 WP_070757174.1 spermidine/putrescine ABC transporter ATP-binding protein PotA -

Sequence

Protein


Download         Length: 107 a.a.        Molecular weight: 12349.19 Da        Isoelectric Point: 9.6244

>NTDB_id=429097 BHV55_RS06850 WP_000578885.1 1330478..1330801(-) (sinR) [Bacillus sp. RZ2MS9]
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDTLLHDETTKETNLDSEWTQLV
KDAMNSGVSKEQFREFLEFTKWKQNQK

Nucleotide


Download         Length: 324 bp        

>NTDB_id=429097 BHV55_RS06850 WP_000578885.1 1330478..1330801(-) (sinR) [Bacillus sp. RZ2MS9]
ATGATTGGAGAACGTATAAAACGCCTTCGTTTACAAAAAGGGATTTCATTAACTGAACTTGCCGAAAAAGCTGGCGTTGC
TAAATCTTACATTAGTTCTATAGAACGAAATTTACAAAAAAACCCTTCCATTCAGTTTCTTGAAAAGATCGCAGCAGTTC
TACAAATTCCAGTTGATACTTTACTTCATGATGAAACAACAAAGGAAACTAACCTAGACTCCGAATGGACACAACTCGTT
AAAGATGCAATGAACTCTGGTGTCTCCAAAGAACAATTTCGTGAATTTCTTGAATTTACAAAGTGGAAGCAAAATCAAAA
ATAA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(6-60)

Anti-repressor SinI (SinI)

(72-99)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

67.89

100

0.692