Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   G4G26_RS12250 Genome accession   NZ_CP049924
Coordinates   2416575..2416748 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain So1b     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2411575..2421748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4G26_RS12235 (G4G26_12270) gcvT 2412375..2413463 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  G4G26_RS12240 (G4G26_12275) yqhH 2413904..2415577 (+) 1674 WP_029726726.1 SNF2-related protein -
  G4G26_RS12245 (G4G26_12280) yqhG 2415598..2416392 (+) 795 WP_015714249.1 YqhG family protein -
  G4G26_RS12250 (G4G26_12285) sinI 2416575..2416748 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  G4G26_RS12255 (G4G26_12290) sinR 2416782..2417117 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  G4G26_RS12260 (G4G26_12295) tasA 2417210..2417995 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  G4G26_RS12265 (G4G26_12300) sipW 2418059..2418631 (-) 573 WP_003230181.1 signal peptidase I -
  G4G26_RS12270 (G4G26_12305) tapA 2418615..2419376 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  G4G26_RS12275 (G4G26_12310) yqzG 2419648..2419974 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  G4G26_RS12280 (G4G26_12315) spoIIT 2420016..2420195 (-) 180 WP_014480252.1 YqzE family protein -
  G4G26_RS12285 (G4G26_12320) comGG 2420266..2420640 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  G4G26_RS12290 (G4G26_12325) comGF 2420641..2421024 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  G4G26_RS12295 (G4G26_12330) comGE 2421050..2421397 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=428733 G4G26_RS12250 WP_003230187.1 2416575..2416748(+) (sinI) [Bacillus subtilis strain So1b]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=428733 G4G26_RS12250 WP_003230187.1 2416575..2416748(+) (sinI) [Bacillus subtilis strain So1b]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1