Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   V753_RS11630 Genome accession   NZ_CP049904
Coordinates   2429163..2429540 (-) Length   125 a.a.
NCBI ID   WP_007612567.1    Uniprot ID   -
Organism   Bacillus velezensis strain GB03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2424163..2434540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V753_RS11590 (V753_11565) - 2424660..2425454 (+) 795 WP_007612541.1 YqhG family protein -
  V753_RS11595 (V753_11570) sinI 2425631..2425804 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  V753_RS11600 (V753_11575) sinR 2425838..2426173 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V753_RS11605 (V753_11580) tasA 2426221..2427006 (-) 786 WP_007612547.1 biofilm matrix protein TasA -
  V753_RS11610 (V753_11585) sipW 2427071..2427655 (-) 585 WP_007612550.1 signal peptidase I SipW -
  V753_RS11615 (V753_11590) tapA 2427627..2428298 (-) 672 WP_029326077.1 amyloid fiber anchoring/assembly protein TapA -
  V753_RS11620 (V753_11595) - 2428557..2428886 (+) 330 WP_007612559.1 DUF3889 domain-containing protein -
  V753_RS11625 (V753_11600) - 2428927..2429106 (-) 180 WP_003153093.1 YqzE family protein -
  V753_RS11630 (V753_11605) comGG 2429163..2429540 (-) 378 WP_007612567.1 competence type IV pilus minor pilin ComGG Machinery gene
  V753_RS11635 (V753_11610) comGF 2429541..2430005 (-) 465 WP_228767516.1 competence type IV pilus minor pilin ComGF -
  V753_RS11640 (V753_11615) comGE 2429950..2430264 (-) 315 WP_029326075.1 competence type IV pilus minor pilin ComGE -
  V753_RS11645 (V753_11620) comGD 2430248..2430685 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  V753_RS11650 (V753_11625) comGC 2430675..2430983 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V753_RS11655 (V753_11630) comGB 2430988..2432025 (-) 1038 WP_029326074.1 competence type IV pilus assembly protein ComGB Machinery gene
  V753_RS11660 (V753_11635) comGA 2432012..2433082 (-) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  V753_RS11665 (V753_11640) - 2433279..2434229 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14238.13 Da        Isoelectric Point: 9.7160

>NTDB_id=428503 V753_RS11630 WP_007612567.1 2429163..2429540(-) (comGG) [Bacillus velezensis strain GB03]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFEKEAGEYWIGENLLQNGALLSSRHMTQGQKARTGTQRFPYGTVS
FHINGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=428503 V753_RS11630 WP_007612567.1 2429163..2429540(-) (comGG) [Bacillus velezensis strain GB03]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGAAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CACTGCTGTCAAGCCGTCATATGACACAGGGACAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCAACGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504