Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | G6536_RS18700 | Genome accession | NZ_CP049330 |
| Coordinates | 3588011..3588295 (-) | Length | 94 a.a. |
| NCBI ID | WP_003185421.1 | Uniprot ID | A0A1Y0XQV9 |
| Organism | Bacillus licheniformis strain CP6 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3539342..3589679 | 3588011..3588295 | within | 0 |
Gene organization within MGE regions
Location: 3539342..3589679
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6536_RS18390 (G6536_18615) | - | 3539342..3541060 (+) | 1719 | WP_061578382.1 | T7SS effector LXG polymorphic toxin | - |
| G6536_RS18395 (G6536_18620) | - | 3541066..3541350 (+) | 285 | WP_003185302.1 | hypothetical protein | - |
| G6536_RS18400 (G6536_18625) | - | 3541381..3541683 (-) | 303 | Protein_3610 | peptidoglycan-binding domain-containing protein | - |
| G6536_RS18405 (G6536_18630) | - | 3542083..3542235 (+) | 153 | WP_011198291.1 | hypothetical protein | - |
| G6536_RS18410 (G6536_18635) | - | 3542306..3542896 (+) | 591 | WP_003185308.1 | hypothetical protein | - |
| G6536_RS18415 (G6536_18640) | - | 3542998..3543372 (+) | 375 | Protein_3613 | YolD-like family protein | - |
| G6536_RS18420 (G6536_18645) | - | 3543780..3544490 (-) | 711 | WP_003185310.1 | DUF421 domain-containing protein | - |
| G6536_RS18425 (G6536_18650) | - | 3544698..3545549 (+) | 852 | WP_035334177.1 | ferritin family protein | - |
| G6536_RS18430 (G6536_18655) | - | 3545705..3546298 (+) | 594 | WP_003185315.1 | cupin domain-containing protein | - |
| G6536_RS18435 (G6536_18660) | - | 3546419..3547372 (-) | 954 | WP_003185317.1 | glycoside hydrolase family 25 protein | - |
| G6536_RS18440 (G6536_18665) | - | 3547420..3547683 (-) | 264 | WP_003185319.1 | phage holin | - |
| G6536_RS18445 (G6536_18670) | - | 3547699..3547968 (-) | 270 | WP_003185322.1 | hemolysin XhlA family protein | - |
| G6536_RS18450 (G6536_18675) | - | 3548031..3548216 (-) | 186 | WP_003185324.1 | XkdX family protein | - |
| G6536_RS18455 (G6536_18680) | - | 3548213..3548536 (-) | 324 | WP_003185326.1 | bZIP transcription factor | - |
| G6536_RS18460 (G6536_18685) | - | 3548549..3549886 (-) | 1338 | WP_003185328.1 | BppU family phage baseplate upper protein | - |
| G6536_RS22450 | - | 3549907..3551952 (-) | 2046 | WP_035334112.1 | hypothetical protein | - |
| G6536_RS18470 (G6536_18695) | - | 3551989..3553701 (-) | 1713 | WP_003185331.1 | phage tail protein | - |
| G6536_RS18475 (G6536_18700) | - | 3553714..3554550 (-) | 837 | WP_003185333.1 | phage tail family protein | - |
| G6536_RS18480 (G6536_18705) | - | 3554550..3559022 (-) | 4473 | WP_098408398.1 | phage tail tape measure protein | - |
| G6536_RS18485 (G6536_18710) | - | 3559231..3559593 (-) | 363 | WP_003185339.1 | hypothetical protein | - |
| G6536_RS18490 (G6536_18715) | - | 3559647..3560264 (-) | 618 | WP_003185341.1 | major tail protein | - |
| G6536_RS18495 (G6536_18720) | - | 3560279..3560662 (-) | 384 | WP_003185344.1 | hypothetical protein | - |
| G6536_RS18500 (G6536_18725) | - | 3560659..3561057 (-) | 399 | WP_003185346.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| G6536_RS18505 (G6536_18730) | - | 3561057..3561365 (-) | 309 | WP_003185349.1 | phage head closure protein | - |
| G6536_RS18510 (G6536_18735) | - | 3561355..3561657 (-) | 303 | WP_003185351.1 | head-tail connector protein | - |
| G6536_RS18515 (G6536_18740) | - | 3561678..3562103 (-) | 426 | WP_003185353.1 | collagen-like protein | - |
| G6536_RS18520 (G6536_18745) | - | 3562127..3563410 (-) | 1284 | WP_048350601.1 | phage major capsid protein | - |
| G6536_RS18525 (G6536_18750) | - | 3563449..3564180 (-) | 732 | WP_021837714.1 | head maturation protease, ClpP-related | - |
| G6536_RS18530 (G6536_18755) | - | 3564125..3565435 (-) | 1311 | WP_003185359.1 | phage portal protein | - |
| G6536_RS18535 (G6536_18760) | - | 3565436..3565627 (-) | 192 | WP_003185361.1 | DUF1056 family protein | - |
| G6536_RS18540 (G6536_18765) | - | 3565639..3567348 (-) | 1710 | WP_003185362.1 | terminase TerL endonuclease subunit | - |
| G6536_RS18545 (G6536_18770) | - | 3567345..3567860 (-) | 516 | WP_003185364.1 | phage terminase small subunit P27 family | - |
| G6536_RS18550 (G6536_18775) | - | 3568090..3568464 (-) | 375 | WP_021837717.1 | HNH endonuclease | - |
| G6536_RS18555 (G6536_18780) | - | 3568491..3568799 (-) | 309 | WP_048350608.1 | hypothetical protein | - |
| G6536_RS18560 (G6536_18785) | cotD | 3569020..3569244 (-) | 225 | WP_006637235.1 | spore coat protein CotD | - |
| G6536_RS18565 (G6536_18790) | - | 3569994..3570374 (-) | 381 | WP_009329244.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| G6536_RS18570 (G6536_18795) | - | 3570487..3570885 (-) | 399 | WP_073513083.1 | YopX family protein | - |
| G6536_RS18575 (G6536_18800) | - | 3570901..3571416 (-) | 516 | WP_073513081.1 | putative metallopeptidase | - |
| G6536_RS18580 (G6536_18805) | - | 3571420..3571590 (-) | 171 | WP_071583658.1 | Fur-regulated basic protein FbpA | - |
| G6536_RS18585 (G6536_18810) | - | 3571587..3572126 (-) | 540 | WP_073358634.1 | ERCC4 domain-containing protein | - |
| G6536_RS18590 (G6536_18815) | - | 3572123..3572560 (-) | 438 | WP_073358636.1 | hypothetical protein | - |
| G6536_RS18595 (G6536_18820) | - | 3572538..3572801 (-) | 264 | WP_016886542.1 | hypothetical protein | - |
| G6536_RS18600 (G6536_18825) | - | 3573077..3575509 (-) | 2433 | WP_073358638.1 | phage/plasmid primase, P4 family | - |
| G6536_RS18605 (G6536_18830) | - | 3575570..3576007 (-) | 438 | WP_061565940.1 | DUF669 domain-containing protein | - |
| G6536_RS18610 (G6536_18835) | - | 3576007..3576939 (-) | 933 | WP_061565941.1 | AAA family ATPase | - |
| G6536_RS18615 (G6536_18840) | - | 3576943..3577500 (-) | 558 | WP_061565942.1 | host-nuclease inhibitor Gam family protein | - |
| G6536_RS18620 (G6536_18845) | - | 3577593..3577835 (-) | 243 | WP_011198322.1 | hypothetical protein | - |
| G6536_RS18625 (G6536_18850) | - | 3577923..3578189 (-) | 267 | WP_061565943.1 | YqaH family protein | - |
| G6536_RS18630 (G6536_18855) | - | 3578249..3578629 (+) | 381 | WP_003185396.1 | DUF2513 domain-containing protein | - |
| G6536_RS18635 (G6536_18860) | - | 3578621..3578791 (-) | 171 | WP_003185398.1 | hypothetical protein | - |
| G6536_RS18640 (G6536_18865) | - | 3579135..3579689 (-) | 555 | WP_003185401.1 | hypothetical protein | - |
| G6536_RS18645 (G6536_18870) | - | 3579747..3579935 (-) | 189 | WP_016886536.1 | hypothetical protein | - |
| G6536_RS18650 (G6536_18875) | - | 3580067..3580255 (-) | 189 | WP_003185403.1 | helix-turn-helix domain-containing protein | - |
| G6536_RS18655 (G6536_18880) | - | 3580252..3581046 (-) | 795 | WP_098408310.1 | ORF6N domain-containing protein | - |
| G6536_RS18660 (G6536_18885) | - | 3581071..3581289 (-) | 219 | WP_003185407.1 | helix-turn-helix transcriptional regulator | - |
| G6536_RS18665 (G6536_18890) | - | 3581466..3582104 (+) | 639 | WP_003185408.1 | XRE family transcriptional regulator | - |
| G6536_RS18670 (G6536_18895) | - | 3582175..3583269 (+) | 1095 | WP_098408312.1 | site-specific integrase | - |
| G6536_RS18680 (G6536_18905) | smpB | 3583821..3584294 (-) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| G6536_RS18685 (G6536_18910) | rnr | 3584406..3586709 (-) | 2304 | WP_003185414.1 | ribonuclease R | - |
| G6536_RS18690 (G6536_18915) | - | 3586723..3587469 (-) | 747 | WP_011198329.1 | carboxylesterase | - |
| G6536_RS18695 (G6536_18920) | secG | 3587610..3587840 (-) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| G6536_RS18700 (G6536_18925) | abrB | 3588011..3588295 (-) | 285 | WP_003185421.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| G6536_RS18705 (G6536_18930) | - | 3588324..3588557 (-) | 234 | WP_085959538.1 | helix-turn-helix transcriptional regulator | - |
| G6536_RS18710 (G6536_18935) | - | 3588710..3589111 (+) | 402 | WP_009329609.1 | transcriptional regulator | - |
| G6536_RS18715 (G6536_18940) | - | 3589281..3589679 (+) | 399 | WP_009329610.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10486.36 Da Isoelectric Point: 7.9620
>NTDB_id=426124 G6536_RS18700 WP_003185421.1 3588011..3588295(-) (abrB) [Bacillus licheniformis strain CP6]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=426124 G6536_RS18700 WP_003185421.1 3588011..3588295(-) (abrB) [Bacillus licheniformis strain CP6]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.044 |
96.809 |
0.543 |