Detailed information    

insolico Bioinformatically predicted

Overview

Name   rapC   Type   Regulator
Locus tag   G4P54_RS21320 Genome accession   NZ_CP048852
Coordinates   2082096..2082305 (+) Length   69 a.a.
NCBI ID   WP_240939658.1    Uniprot ID   -
Organism   Bacillus tequilensis strain EA-CB0015     
Function   inhibit the DNA-binding function of ComA (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2075755..2094822 2082096..2082305 within 0


Gene organization within MGE regions


Location: 2075755..2094822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4P54_RS10845 (G4P54_10810) - 2075755..2076129 (+) 375 WP_167872660.1 YoqO family protein -
  G4P54_RS10850 (G4P54_10815) - 2076526..2077662 (+) 1137 WP_024715416.1 tetratricopeptide repeat protein -
  G4P54_RS10855 (G4P54_10820) - 2077652..2077831 (+) 180 WP_024715415.1 hypothetical protein -
  G4P54_RS10860 (G4P54_10825) - 2078055..2079074 (+) 1020 WP_167872661.1 hypothetical protein -
  G4P54_RS10865 (G4P54_10830) - 2079148..2079507 (-) 360 WP_024715413.1 hypothetical protein -
  G4P54_RS10870 (G4P54_10835) - 2079787..2080320 (-) 534 WP_024715412.1 GNAT family N-acetyltransferase -
  G4P54_RS21310 - 2080406..2080546 (-) 141 WP_240939656.1 hypothetical protein -
  G4P54_RS21315 - 2080522..2080647 (-) 126 WP_240939783.1 hypothetical protein -
  G4P54_RS10880 (G4P54_10845) - 2081042..2081875 (-) 834 WP_167872662.1 hypothetical protein -
  G4P54_RS21320 rapC 2082096..2082305 (+) 210 WP_240939658.1 hypothetical protein Regulator
  G4P54_RS21325 - 2082360..2082416 (+) 57 Protein_2110 hypothetical protein -
  G4P54_RS21330 - 2082420..2082854 (+) 435 WP_240939660.1 tetratricopeptide repeat protein -
  G4P54_RS10890 (G4P54_10855) - 2082844..2082987 (+) 144 WP_167872663.1 hypothetical protein -
  G4P54_RS10895 (G4P54_10860) - 2083061..2083402 (-) 342 WP_167873865.1 SLATT domain-containing protein -
  G4P54_RS10900 (G4P54_10865) - 2083757..2084323 (-) 567 WP_167872664.1 SMI1/KNR4 family protein -
  G4P54_RS10905 (G4P54_10870) - 2084389..2084579 (-) 191 Protein_2115 hypothetical protein -
  G4P54_RS21335 (G4P54_10875) - 2084781..2084894 (+) 114 WP_167873866.1 excalibur calcium-binding domain-containing protein -
  G4P54_RS21650 (G4P54_10880) - 2084916..2085404 (-) 489 WP_167872665.1 hypothetical protein -
  G4P54_RS10920 (G4P54_10885) - 2085823..2086041 (-) 219 WP_167873867.1 helix-turn-helix domain-containing protein -
  G4P54_RS10925 (G4P54_10890) - 2086244..2086945 (-) 702 WP_167872666.1 hypothetical protein -
  G4P54_RS10930 (G4P54_10895) - 2087008..2087202 (-) 195 WP_167872667.1 hypothetical protein -
  G4P54_RS10935 (G4P54_10900) - 2087563..2087877 (-) 315 WP_167872668.1 XkdW family protein -
  G4P54_RS21130 (G4P54_10905) - 2087954..2088335 (-) 382 Protein_2122 hypothetical protein -
  G4P54_RS21345 - 2088401..2088652 (+) 252 WP_240939661.1 hypothetical protein -
  G4P54_RS21350 - 2088686..2089183 (+) 498 Protein_2124 SAR2788 family putative toxin -
  G4P54_RS10950 (G4P54_10910) - 2089314..2090231 (-) 918 WP_167872671.1 hypothetical protein -
  G4P54_RS10955 (G4P54_10915) - 2090296..2090463 (-) 168 Protein_2126 hypothetical protein -
  G4P54_RS10960 (G4P54_10920) - 2090607..2090830 (+) 224 Protein_2127 hypothetical protein -
  G4P54_RS10965 (G4P54_10925) - 2090845..2091135 (-) 291 Protein_2128 hypothetical protein -
  G4P54_RS10970 (G4P54_10930) - 2091260..2091634 (+) 375 WP_167872673.1 YoqO family protein -
  G4P54_RS10975 (G4P54_10935) - 2091877..2092614 (+) 738 WP_240939662.1 hypothetical protein -
  G4P54_RS10980 (G4P54_10940) - 2092665..2093027 (+) 363 WP_167873868.1 DUF1433 domain-containing protein -
  G4P54_RS10985 (G4P54_10945) - 2093202..2093432 (+) 231 WP_167872674.1 hypothetical protein -
  G4P54_RS21355 - 2093512..2093746 (-) 235 Protein_2133 M15 family peptidase -
  G4P54_RS21360 - 2093778..2094025 (-) 248 Protein_2134 M15 family metallopeptidase -
  G4P54_RS10995 (G4P54_10950) csaA 2094490..2094822 (-) 333 WP_024715408.1 chaperone CsaA -

Sequence

Protein


Download         Length: 69 a.a.        Molecular weight: 8198.50 Da        Isoelectric Point: 7.2725

>NTDB_id=423604 G4P54_RS21320 WP_240939658.1 2082096..2082305(+) (rapC) [Bacillus tequilensis strain EA-CB0015]
MLKKLALVTDEIERAEFYFKMAEVYYHMKQTHVSMHYAEAALNIYKDQKTYTVRRIQCAFVVAGNFDDL

Nucleotide


Download         Length: 210 bp        

>NTDB_id=423604 G4P54_RS21320 WP_240939658.1 2082096..2082305(+) (rapC) [Bacillus tequilensis strain EA-CB0015]
TTGCTGAAAAAGCTCGCTCTAGTAACAGACGAAATTGAACGTGCTGAGTTTTATTTCAAAATGGCTGAAGTGTATTATCA
CATGAAACAAACCCATGTATCAATGCACTATGCTGAAGCTGCGCTTAATATTTATAAAGACCAAAAAACTTATACTGTTC
GTCGAATTCAATGTGCTTTTGTTGTAGCTGGGAACTTTGATGATTTGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rapC Bacillus subtilis subsp. subtilis str. 168

57.576

95.652

0.551
  rapF Bacillus subtilis subsp. subtilis str. 168

54.545

95.652

0.522