Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   G4P54_RS16220 Genome accession   NZ_CP048852
Coordinates   3051114..3051254 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus tequilensis strain EA-CB0015     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3046114..3056254
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4P54_RS16195 (G4P54_16150) - 3046397..3046777 (-) 381 WP_024713714.1 hotdog fold thioesterase -
  G4P54_RS16200 (G4P54_16155) comA 3046795..3047439 (-) 645 WP_024713713.1 two-component system response regulator ComA Regulator
  G4P54_RS16205 (G4P54_16160) comP 3047520..3049826 (-) 2307 WP_167873219.1 histidine kinase Regulator
  G4P54_RS16210 (G4P54_16165) comX 3049842..3050063 (-) 222 WP_024713711.1 competence pheromone ComX -
  G4P54_RS16215 (G4P54_16170) - 3050060..3050929 (-) 870 WP_024713710.1 polyprenyl synthetase family protein -
  G4P54_RS16220 (G4P54_16175) degQ 3051114..3051254 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  G4P54_RS16225 (G4P54_16180) - 3051716..3052084 (+) 369 WP_024713708.1 hypothetical protein -
  G4P54_RS16230 (G4P54_16185) pdeH 3052060..3053289 (-) 1230 WP_167873220.1 cyclic di-GMP phosphodiesterase -
  G4P54_RS16235 (G4P54_16190) - 3053424..3054896 (-) 1473 WP_024713706.1 nicotinate phosphoribosyltransferase -
  G4P54_RS16240 (G4P54_16195) - 3054912..3055463 (-) 552 WP_167873221.1 cysteine hydrolase family protein -
  G4P54_RS16245 (G4P54_16200) - 3055560..3055958 (-) 399 WP_167873222.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=423589 G4P54_RS16220 WP_003220708.1 3051114..3051254(-) (degQ) [Bacillus tequilensis strain EA-CB0015]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=423589 G4P54_RS16220 WP_003220708.1 3051114..3051254(-) (degQ) [Bacillus tequilensis strain EA-CB0015]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1