Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BAMOH1_RS01930 Genome accession   NZ_CP061853
Coordinates   388135..388254 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens strain MOH1-5b     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 383135..393254
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMOH1_RS01915 (BAMOH1_01915) - 384747..385430 (+) 684 WP_014416901.1 response regulator transcription factor -
  BAMOH1_RS01920 (BAMOH1_01920) - 385417..386844 (+) 1428 WP_088056326.1 HAMP domain-containing sensor histidine kinase -
  BAMOH1_RS01925 (BAMOH1_01925) rapC 387003..388151 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BAMOH1_RS01930 (BAMOH1_01930) phrC 388135..388254 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAMOH1_RS01935 (BAMOH1_01935) - 388406..388516 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  BAMOH1_RS01940 (BAMOH1_01940) - 388596..389960 (-) 1365 WP_021495117.1 aspartate kinase -
  BAMOH1_RS01945 (BAMOH1_01945) ceuB 390374..391327 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  BAMOH1_RS01950 (BAMOH1_01950) - 391317..392264 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  BAMOH1_RS01955 (BAMOH1_01955) - 392258..393016 (+) 759 WP_063636991.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=423283 BAMOH1_RS01930 WP_003156334.1 388135..388254(+) (phrC) [Bacillus amyloliquefaciens strain MOH1-5b]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=423283 BAMOH1_RS01930 WP_003156334.1 388135..388254(+) (phrC) [Bacillus amyloliquefaciens strain MOH1-5b]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718