Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   G4D59_RS14770 Genome accession   NZ_CP048811
Coordinates   2846741..2846881 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain SCU11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2841741..2851881
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G4D59_RS14745 (G4D59_14670) - 2842063..2842452 (-) 390 WP_017367960.1 hotdog fold thioesterase -
  G4D59_RS14750 (G4D59_14675) comA 2842476..2843117 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  G4D59_RS14755 (G4D59_14680) comP 2843198..2845504 (-) 2307 WP_017367961.1 ATP-binding protein Regulator
  G4D59_RS14760 (G4D59_14685) comX 2845518..2845688 (-) 171 WP_008345861.1 competence pheromone ComX -
  G4D59_RS14765 (G4D59_14690) - 2845666..2846589 (-) 924 WP_017367962.1 polyprenyl synthetase family protein -
  G4D59_RS14770 (G4D59_14695) degQ 2846741..2846881 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  G4D59_RS14775 (G4D59_14700) - 2847387..2847740 (+) 354 WP_017367963.1 hypothetical protein -
  G4D59_RS14780 (G4D59_14705) - 2847777..2849003 (-) 1227 WP_017367964.1 EAL and HDOD domain-containing protein -
  G4D59_RS14785 (G4D59_14710) - 2849144..2850613 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  G4D59_RS14790 (G4D59_14715) - 2850631..2851182 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  G4D59_RS14795 (G4D59_14720) - 2851243..2851650 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=423224 G4D59_RS14770 WP_003213123.1 2846741..2846881(-) (degQ) [Bacillus altitudinis strain SCU11]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=423224 G4D59_RS14770 WP_003213123.1 2846741..2846881(-) (degQ) [Bacillus altitudinis strain SCU11]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment