Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   G3T58_RS28025 Genome accession   NZ_CP048687
Coordinates   5514397..5514675 (-) Length   92 a.a.
NCBI ID   WP_000799086.1    Uniprot ID   A0A7D8D6B3
Organism   Bacillus paranthracis strain MN1F     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 5508425..5539119 5514397..5514675 within 0


Gene organization within MGE regions


Location: 5508425..5539119
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G3T58_RS27960 - 5508779..5508919 (-) 141 WP_002028328.1 hypothetical protein -
  G3T58_RS27965 - 5509053..5509184 (-) 132 WP_001061241.1 DUF3983 domain-containing protein -
  G3T58_RS27970 - 5509507..5509755 (-) 249 WP_000033082.1 helix-turn-helix domain-containing protein -
  G3T58_RS27975 - 5509976..5510239 (-) 264 WP_000678894.1 hypothetical protein -
  G3T58_RS27980 - 5510273..5510470 (-) 198 WP_000439567.1 hypothetical protein -
  G3T58_RS27985 - 5510505..5510732 (-) 228 WP_000661412.1 hypothetical protein -
  G3T58_RS27990 - 5510770..5510991 (-) 222 WP_001216585.1 hypothetical protein -
  G3T58_RS29775 - 5511308..5511613 (-) 306 WP_033679841.1 hypothetical protein -
  G3T58_RS29780 - 5511671..5511982 (-) 312 Protein_5586 YopX family protein -
  G3T58_RS28000 - 5512010..5512555 (-) 546 WP_001030638.1 hypothetical protein -
  G3T58_RS28005 - 5513080..5513562 (-) 483 WP_001102009.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  G3T58_RS28010 - 5513582..5513833 (-) 252 WP_000109486.1 hypothetical protein -
  G3T58_RS28015 - 5513859..5514026 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  G3T58_RS28020 - 5514045..5514404 (-) 360 WP_001125952.1 hypothetical protein -
  G3T58_RS28025 abrB 5514397..5514675 (-) 279 WP_000799086.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  G3T58_RS28030 - 5514692..5514886 (-) 195 WP_000338031.1 hypothetical protein -
  G3T58_RS28035 - 5514899..5515813 (-) 915 WP_001171109.1 AAA family ATPase -
  G3T58_RS28040 - 5515828..5516712 (-) 885 WP_001151930.1 conserved phage C-terminal domain-containing protein -
  G3T58_RS29345 - 5516717..5516893 (-) 177 WP_001241127.1 hypothetical protein -
  G3T58_RS29350 - 5516923..5517087 (-) 165 WP_000390319.1 hypothetical protein -
  G3T58_RS28045 - 5517143..5517418 (-) 276 WP_033670234.1 helix-turn-helix domain-containing protein -
  G3T58_RS28050 - 5517574..5517759 (-) 186 WP_000854265.1 helix-turn-helix transcriptional regulator -
  G3T58_RS28055 - 5517961..5518314 (+) 354 WP_000481767.1 helix-turn-helix transcriptional regulator -
  G3T58_RS29930 - 5518351..5518485 (-) 135 WP_000650968.1 hypothetical protein -
  G3T58_RS28060 - 5518723..5519916 (-) 1194 WP_000803132.1 AimR family lysis-lysogeny pheromone receptor -
  G3T58_RS28065 - 5520215..5521324 (+) 1110 WP_000675867.1 tyrosine-type recombinase/integrase -
  G3T58_RS28070 - 5521407..5521583 (-) 177 Protein_5604 VOC family protein -
  G3T58_RS28075 - 5521707..5522876 (-) 1170 WP_000588613.1 DEAD/DEAH box helicase -
  G3T58_RS28080 - 5522896..5523423 (-) 528 WP_000460208.1 hypothetical protein -
  G3T58_RS28085 - 5523514..5525202 (-) 1689 WP_012580602.1 formate--tetrahydrofolate ligase -
  G3T58_RS28090 - 5525266..5525976 (-) 711 WP_154981898.1 class I SAM-dependent methyltransferase -
  G3T58_RS28095 - 5526182..5526520 (+) 339 WP_001253199.1 hypothetical protein -
  G3T58_RS28100 - 5526550..5526762 (-) 213 WP_000711202.1 hypothetical protein -
  G3T58_RS28105 - 5526832..5527152 (-) 321 WP_000761177.1 hypothetical protein -
  G3T58_RS28110 - 5527204..5527980 (-) 777 WP_000014091.1 oxalate:formate antiporter -
  G3T58_RS28115 ytfJ 5528141..5528566 (-) 426 WP_000349987.1 GerW family sporulation protein -
  G3T58_RS28120 - 5528699..5529484 (+) 786 WP_000984767.1 GNAT family N-acetyltransferase -
  G3T58_RS28125 - 5529513..5529650 (-) 138 WP_001250696.1 hypothetical protein -
  G3T58_RS28130 - 5529682..5530110 (-) 429 WP_000570282.1 GNAT family N-acetyltransferase -
  G3T58_RS28135 - 5530107..5530478 (-) 372 WP_000688099.1 hypothetical protein -
  G3T58_RS28140 - 5530491..5530976 (-) 486 WP_000222820.1 GNAT family N-acetyltransferase -
  G3T58_RS28145 - 5530973..5531533 (-) 561 WP_000270875.1 2'-5' RNA ligase family protein -
  G3T58_RS28150 - 5531540..5532106 (-) 567 WP_000843676.1 GNAT family protein -
  G3T58_RS28155 - 5532243..5532868 (+) 626 Protein_5621 DUF1648 domain-containing protein -
  G3T58_RS28160 - 5532889..5534016 (-) 1128 WP_000411326.1 metallophosphoesterase -
  G3T58_RS28165 - 5534164..5534586 (-) 423 WP_001021918.1 GNAT family N-acetyltransferase -
  G3T58_RS28170 - 5534717..5536117 (+) 1401 WP_000366295.1 PLP-dependent aminotransferase family protein -
  G3T58_RS28175 - 5536164..5537009 (-) 846 WP_000755118.1 YitT family protein -
  G3T58_RS28180 - 5537177..5538385 (-) 1209 WP_000024474.1 macrolide family glycosyltransferase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10030.62 Da        Isoelectric Point: 8.0774

>NTDB_id=422356 G3T58_RS28025 WP_000799086.1 5514397..5514675(-) (abrB) [Bacillus paranthracis strain MN1F]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALNFHVDGENIVLRKHEKSCFVTGEVSESNMELLGGRMFLSKAGANEL
LNALEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=422356 G3T58_RS28025 WP_000799086.1 5514397..5514675(-) (abrB) [Bacillus paranthracis strain MN1F]
ATGAAAAATACAGGTGTTGCAAGAAAAGTAGATGAACTAGGGCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGAACAGCATTAAACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGTTTTG
TAACAGGTGAAGTTTCTGAATCAAACATGGAATTGTTAGGTGGTCGAATGTTTTTGAGTAAGGCGGGAGCAAATGAGTTA
CTTAATGCTCTTGAAAAGAGCGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A7D8D6B3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.945

98.913

0.543

Multiple sequence alignment