Detailed information
Bioinformatically predicted
Overview
| Name | HI0659 | Type | Machinery gene |
| Locus tag | GXM21_RS04665 | Genome accession | NZ_CP048627 |
| Coordinates | 961122..961364 (+) | Length | 80 a.a. |
| NCBI ID | WP_008538270.1 | Uniprot ID | - |
| Organism | Megamonas funiformis strain JCM 14723 | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 958648..1011250 | 961122..961364 | within | 0 |
Gene organization within MGE regions
Location: 958648..1011250
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GXM21_RS04650 (GXM21_04650) | - | 959257..960363 (-) | 1107 | WP_008538273.1 | site-specific integrase | - |
| GXM21_RS04655 (GXM21_04655) | - | 960469..960729 (+) | 261 | WP_008538272.1 | DUF4160 domain-containing protein | - |
| GXM21_RS04660 (GXM21_04660) | - | 960764..961117 (+) | 354 | WP_008538271.1 | DUF2442 domain-containing protein | - |
| GXM21_RS04665 (GXM21_04665) | HI0659 | 961122..961364 (+) | 243 | WP_008538270.1 | helix-turn-helix transcriptional regulator | Machinery gene |
| GXM21_RS04670 (GXM21_04670) | - | 961409..962506 (-) | 1098 | WP_008538269.1 | SAP domain-containing protein | - |
| GXM21_RS04675 (GXM21_04675) | - | 962561..963010 (-) | 450 | WP_163604675.1 | helix-turn-helix domain-containing protein | - |
| GXM21_RS04680 (GXM21_04680) | - | 963136..963333 (+) | 198 | WP_008538267.1 | helix-turn-helix domain-containing protein | - |
| GXM21_RS04685 (GXM21_04685) | - | 963423..963575 (+) | 153 | WP_008538266.1 | hypothetical protein | - |
| GXM21_RS04690 (GXM21_04690) | - | 963596..964624 (+) | 1029 | WP_008538265.1 | hypothetical protein | - |
| GXM21_RS04695 (GXM21_04695) | - | 964627..964923 (+) | 297 | WP_008538264.1 | hypothetical protein | - |
| GXM21_RS04700 (GXM21_04700) | - | 964962..965453 (+) | 492 | WP_008538263.1 | hypothetical protein | - |
| GXM21_RS04705 (GXM21_04705) | - | 965458..965874 (+) | 417 | WP_154645558.1 | hypothetical protein | - |
| GXM21_RS04710 (GXM21_04710) | - | 966012..967985 (+) | 1974 | WP_008538260.1 | ATP-binding protein | - |
| GXM21_RS04715 (GXM21_04715) | - | 968001..968804 (+) | 804 | WP_008538259.1 | hypothetical protein | - |
| GXM21_RS04720 (GXM21_04720) | - | 968824..969633 (+) | 810 | WP_008538258.1 | MBL fold metallo-hydrolase | - |
| GXM21_RS04725 (GXM21_04725) | - | 969638..970099 (+) | 462 | WP_008538257.1 | hypothetical protein | - |
| GXM21_RS04730 (GXM21_04730) | - | 970101..970709 (+) | 609 | WP_008538256.1 | hypothetical protein | - |
| GXM21_RS04735 (GXM21_04735) | - | 970725..971567 (+) | 843 | WP_163604676.1 | DnaD domain protein | - |
| GXM21_RS04740 (GXM21_04740) | - | 971554..972159 (+) | 606 | WP_008538254.1 | ATP-binding protein | - |
| GXM21_RS04745 (GXM21_04745) | - | 972164..972472 (+) | 309 | WP_008538253.1 | hypothetical protein | - |
| GXM21_RS04750 (GXM21_04750) | - | 972474..972758 (+) | 285 | WP_008538252.1 | hypothetical protein | - |
| GXM21_RS04755 (GXM21_04755) | - | 972803..973180 (+) | 378 | WP_008538251.1 | hypothetical protein | - |
| GXM21_RS04760 (GXM21_04760) | - | 973190..973648 (+) | 459 | WP_008538250.1 | DUF3850 domain-containing protein | - |
| GXM21_RS04765 (GXM21_04765) | - | 973626..974129 (+) | 504 | WP_008538249.1 | hypothetical protein | - |
| GXM21_RS04770 (GXM21_04770) | - | 974122..974619 (+) | 498 | WP_008538247.1 | hypothetical protein | - |
| GXM21_RS04775 (GXM21_04775) | - | 974626..974808 (+) | 183 | WP_008538245.1 | hypothetical protein | - |
| GXM21_RS04780 (GXM21_04780) | - | 974798..975226 (+) | 429 | WP_008538244.1 | hypothetical protein | - |
| GXM21_RS04785 (GXM21_04785) | - | 975244..975717 (+) | 474 | WP_008538243.1 | YopX family protein | - |
| GXM21_RS04790 (GXM21_04790) | - | 975970..976173 (+) | 204 | WP_008538241.1 | hypothetical protein | - |
| GXM21_RS04795 (GXM21_04795) | - | 976385..976879 (+) | 495 | WP_008538239.1 | sigma-70 family RNA polymerase sigma factor | - |
| GXM21_RS04800 (GXM21_04800) | - | 977139..977894 (+) | 756 | WP_163604677.1 | ParB N-terminal domain-containing protein | - |
| GXM21_RS04805 (GXM21_04805) | - | 977887..978753 (+) | 867 | WP_008538237.1 | hypothetical protein | - |
| GXM21_RS04810 (GXM21_04810) | - | 978837..979778 (+) | 942 | WP_008538236.1 | radical SAM protein | - |
| GXM21_RS04815 (GXM21_04815) | - | 979824..980255 (+) | 432 | WP_008538234.1 | hypothetical protein | - |
| GXM21_RS04820 (GXM21_04820) | - | 980242..981654 (+) | 1413 | WP_008538233.1 | hypothetical protein | - |
| GXM21_RS04825 (GXM21_04825) | - | 981728..983143 (+) | 1416 | WP_211373393.1 | phage portal protein | - |
| GXM21_RS04830 (GXM21_04830) | - | 983140..984108 (+) | 969 | WP_008538231.1 | hypothetical protein | - |
| GXM21_RS04835 (GXM21_04835) | - | 984126..985421 (+) | 1296 | WP_050900407.1 | hypothetical protein | - |
| GXM21_RS04840 (GXM21_04840) | - | 985440..986138 (+) | 699 | WP_008538229.1 | DUF2190 family protein | - |
| GXM21_RS04845 (GXM21_04845) | - | 986152..987186 (+) | 1035 | WP_008538228.1 | hypothetical protein | - |
| GXM21_RS04850 (GXM21_04850) | - | 987199..987561 (+) | 363 | WP_008538227.1 | hypothetical protein | - |
| GXM21_RS04855 (GXM21_04855) | - | 987558..987947 (+) | 390 | WP_008538226.1 | hypothetical protein | - |
| GXM21_RS04860 (GXM21_04860) | - | 987958..988371 (+) | 414 | WP_008538225.1 | hypothetical protein | - |
| GXM21_RS04865 (GXM21_04865) | - | 988375..989241 (+) | 867 | WP_008538223.1 | DUF3168 domain-containing protein | - |
| GXM21_RS04870 (GXM21_04870) | - | 989241..989465 (+) | 225 | WP_008538222.1 | hypothetical protein | - |
| GXM21_RS04875 (GXM21_04875) | - | 989482..990948 (+) | 1467 | WP_008538220.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| GXM21_RS04880 (GXM21_04880) | - | 990963..991397 (+) | 435 | WP_008538219.1 | phage tail tube protein | - |
| GXM21_RS04885 (GXM21_04885) | - | 991421..991915 (+) | 495 | WP_008538218.1 | hypothetical protein | - |
| GXM21_RS04890 (GXM21_04890) | - | 992087..995092 (+) | 3006 | WP_008538216.1 | phage tail tape measure protein | - |
| GXM21_RS04895 (GXM21_04895) | - | 995097..995873 (+) | 777 | WP_008538215.1 | LysM peptidoglycan-binding domain-containing protein | - |
| GXM21_RS04900 (GXM21_04900) | - | 995870..996895 (+) | 1026 | WP_008538214.1 | hypothetical protein | - |
| GXM21_RS04905 (GXM21_04905) | - | 996879..997262 (+) | 384 | WP_008538213.1 | hypothetical protein | - |
| GXM21_RS04910 (GXM21_04910) | - | 997265..997717 (+) | 453 | WP_008538211.1 | DUF2634 domain-containing protein | - |
| GXM21_RS13005 | - | 997879..998841 (+) | 963 | Protein_942 | baseplate J/gp47 family protein | - |
| GXM21_RS04925 (GXM21_04925) | - | 998831..999844 (+) | 1014 | WP_163604678.1 | putative phage tail protein | - |
| GXM21_RS04930 (GXM21_04930) | - | 999841..1000314 (+) | 474 | WP_008538206.1 | hypothetical protein | - |
| GXM21_RS12900 | - | 1000324..1001976 (+) | 1653 | WP_008538205.1 | pyocin knob domain-containing protein | - |
| GXM21_RS04940 (GXM21_04940) | - | 1002373..1002600 (+) | 228 | WP_039881330.1 | hypothetical protein | - |
| GXM21_RS04945 (GXM21_04945) | - | 1002602..1002739 (-) | 138 | WP_154645555.1 | hypothetical protein | - |
| GXM21_RS04950 (GXM21_04950) | - | 1004404..1004679 (+) | 276 | WP_008538203.1 | hypothetical protein | - |
| GXM21_RS04955 (GXM21_04955) | - | 1004684..1005094 (+) | 411 | WP_008538202.1 | hypothetical protein | - |
| GXM21_RS12835 | - | 1005087..1005251 (+) | 165 | WP_008538201.1 | hypothetical protein | - |
| GXM21_RS04960 (GXM21_04960) | - | 1005371..1006420 (-) | 1050 | WP_163604679.1 | tyrosine-type recombinase/integrase | - |
| GXM21_RS04965 (GXM21_04965) | - | 1006465..1006803 (+) | 339 | WP_008538197.1 | hypothetical protein | - |
| GXM21_RS04970 (GXM21_04970) | - | 1006805..1006987 (+) | 183 | WP_008538196.1 | hypothetical protein | - |
| GXM21_RS04975 (GXM21_04975) | - | 1007285..1007833 (+) | 549 | WP_008538195.1 | N-acetylmuramoyl-L-alanine amidase | - |
| GXM21_RS04980 (GXM21_04980) | - | 1007844..1008050 (+) | 207 | WP_008538194.1 | hypothetical protein | - |
| GXM21_RS04990 (GXM21_04990) | - | 1008580..1009845 (+) | 1266 | WP_008538193.1 | SLC13 family permease | - |
| GXM21_RS04995 (GXM21_04995) | - | 1009910..1011250 (+) | 1341 | WP_008538192.1 | serine hydroxymethyltransferase | - |
Sequence
Protein
Download Length: 80 a.a. Molecular weight: 8954.69 Da Isoelectric Point: 10.7106
>NTDB_id=421946 GXM21_RS04665 WP_008538270.1 961122..961364(+) (HI0659) [Megamonas funiformis strain JCM 14723]
MNDIKINNLRIAIINELIRAREEQGISQKKLEELSGVKQPVIARIEKGKSIPNTDTLVKLLTPLGKKLVIVPLETVKNTK
MNDIKINNLRIAIINELIRAREEQGISQKKLEELSGVKQPVIARIEKGKSIPNTDTLVKLLTPLGKKLVIVPLETVKNTK
Nucleotide
Download Length: 243 bp
>NTDB_id=421946 GXM21_RS04665 WP_008538270.1 961122..961364(+) (HI0659) [Megamonas funiformis strain JCM 14723]
ATGAATGATATTAAAATAAATAATTTACGTATAGCAATAATTAATGAATTAATAAGAGCTAGAGAGGAACAAGGAATAAG
TCAAAAAAAGCTGGAAGAGCTTAGCGGAGTAAAACAGCCTGTTATTGCTCGTATTGAAAAAGGTAAATCTATTCCTAATA
CAGATACACTCGTAAAATTACTTACACCATTAGGTAAAAAACTGGTTATTGTTCCGCTAGAAACAGTAAAAAATACTAAA
TAA
ATGAATGATATTAAAATAAATAATTTACGTATAGCAATAATTAATGAATTAATAAGAGCTAGAGAGGAACAAGGAATAAG
TCAAAAAAAGCTGGAAGAGCTTAGCGGAGTAAAACAGCCTGTTATTGCTCGTATTGAAAAAGGTAAATCTATTCCTAATA
CAGATACACTCGTAAAATTACTTACACCATTAGGTAAAAAACTGGTTATTGTTCCGCTAGAAACAGTAAAAAATACTAAA
TAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| HI0659 | Haemophilus influenzae Rd KW20 |
63.636 |
96.25 |
0.612 |