Detailed information NTG0419585

Bioinformatically predicted

Overview

• Name: pilJ
• Type: Machinery gene
• Locus tag: GWK36_RS12365
• Genome accession: NZ_CP048029
• Coordinates: 2543909..2544085 (-)
• Length: 58 a.a.
• NCBI ID: WP_166271508.1
• Uniprot ID: A0A6G7VFB4
• Organism: Caldichromatium japonicum strain No.7
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2538909..2549085

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GWK36_RS12355 (GWK36_12340)	uvrA	2540559..2543384 (-)	2826	WP_166271504.1	excinuclease ABC subunit UvrA	-
GWK36_RS12360 (GWK36_12345)	-	2543581..2543898 (-)	318	WP_166271506.1	methyl-accepting chemotaxis protein	-
GWK36_RS12365 (GWK36_12350)	pilJ	2543909..2544085 (-)	177	WP_166271508.1	methyl-accepting chemotaxis protein	Machinery gene
GWK36_RS15725	-	2544095..2544217 (-)	123	WP_281352058.1	hypothetical protein	-
GWK36_RS12370 (GWK36_12355)	-	2544284..2544844 (-)	561	WP_166271510.1	methyl-accepting chemotaxis protein	-
GWK36_RS15080	-	2544854..2545393 (-)	540	WP_210756778.1	RNA-guided endonuclease TnpB family protein	-
GWK36_RS15545 (GWK36_12365)	-	2545645..2546025 (-)	381	WP_246237493.1	hypothetical protein	-
GWK36_RS12385 (GWK36_12370)	-	2546018..2546524 (-)	507	WP_210756779.1	hypothetical protein	-
GWK36_RS12390 (GWK36_12375)	-	2546534..2546686 (-)	153	WP_166271514.1	hypothetical protein	-
GWK36_RS12395 (GWK36_12380)	-	2547097..2548236 (+)	1140	WP_166271516.1	fused response regulator/phosphatase	-

Sequence

Protein

• Length: 58 a.a.
• Molecular weight: 6185.09 Da
• Isoelectric Point: 6.4514

>NTDB_id=419585 GWK36_RS12365 WP_166271508.1 2543909..2544085(-) (pilJ) [Caldichromatium japonicum strain No.7]
MIRRSAEQTNLLALNASIEAAHAGEHGRGFVVVADEVGQLALRTQQAIGQIEGLMKTI

Nucleotide

• Length: 177 bp

>NTDB_id=419585 GWK36_RS12365 WP_166271508.1 2543909..2544085(-) (pilJ) [Caldichromatium japonicum strain No.7]
ATGATCCGCAGGAGCGCAGAGCAGACCAATCTACTTGCTTTGAATGCCTCGATCGAGGCGGCGCACGCCGGCGAGCATGG
GCGCGGCTTTGTTGTGGTTGCCGATGAGGTCGGCCAGCTTGCGCTACGCACCCAGCAGGCGATCGGCCAGATCGAAGGCC
TGATGAAGACGATTTAG

Domains

Predicted by InterproScan.

• Methyl-accepting chemotaxis protein (MCP) signalling domain (MCPsignal) (2-57)

3D structure

• AlphaFold DB: A0A6G7VFB4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilJ	Synechocystis sp. PCC 6803	61.538	89.655	0.552