Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GWK37_RS04505 Genome accession   NZ_CP048002
Coordinates   884851..884991 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CACC 316     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 879851..889991
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GWK37_RS04480 (GWK37_04485) - 880191..880574 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  GWK37_RS04485 (GWK37_04490) comA 880596..881240 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  GWK37_RS04490 (GWK37_04495) comP 881321..883612 (-) 2292 WP_099721970.1 histidine kinase Regulator
  GWK37_RS04495 (GWK37_04500) comX 883624..883788 (-) 165 WP_007613432.1 competence pheromone ComX -
  GWK37_RS04500 (GWK37_04505) - 883788..884699 (-) 912 WP_115941230.1 polyprenyl synthetase family protein -
  GWK37_RS04505 (GWK37_04510) degQ 884851..884991 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  GWK37_RS04510 (GWK37_04515) - 885457..885798 (+) 342 WP_014418765.1 hypothetical protein -
  GWK37_RS04515 (GWK37_04520) - 885805..887028 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  GWK37_RS04520 (GWK37_04525) - 887158..888624 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  GWK37_RS04525 (GWK37_04530) - 888642..889193 (-) 552 WP_115940999.1 cysteine hydrolase family protein -
  GWK37_RS04530 (GWK37_04535) - 889290..889688 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=419220 GWK37_RS04505 WP_003152043.1 884851..884991(-) (degQ) [Bacillus velezensis strain CACC 316]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=419220 GWK37_RS04505 WP_003152043.1 884851..884991(-) (degQ) [Bacillus velezensis strain CACC 316]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment