Detailed information NTG0416836

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: E3S62_RS02580
• Genome accession: NZ_CP047803
• Coordinates: 466574..466885 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472255.1
• Uniprot ID: A0A0U1MLR1
• Organism: Staphylococcus aureus strain UP_1097
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 461574..471885

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E3S62_RS02550 (E3S62_02550)	-	462357..462560 (+)	204	WP_000087561.1	YqgQ family protein	-
E3S62_RS02555 (E3S62_02555)	-	462557..463543 (+)	987	WP_000161307.1	ROK family glucokinase	-
E3S62_RS02560 (E3S62_02560)	-	463543..463872 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
E3S62_RS02565 (E3S62_02565)	-	463869..464492 (+)	624	WP_001223009.1	MBL fold metallo-hydrolase	-
E3S62_RS02570 (E3S62_02570)	comGA	464544..465518 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
E3S62_RS02575 (E3S62_02575)	comGB	465490..466560 (+)	1071	WP_000776409.1	competence type IV pilus assembly protein ComGB	Machinery gene
E3S62_RS02580 (E3S62_02580)	comGC	466574..466885 (+)	312	WP_000472255.1	competence type IV pilus major pilin ComGC	Machinery gene
E3S62_RS02585 (E3S62_02585)	comGD	466863..467309 (+)	447	WP_160199701.1	competence type IV pilus minor pilin ComGD	Machinery gene
E3S62_RS02590 (E3S62_02590)	comGE	467296..467595 (+)	300	WP_195758580.1	competence protein ComGE	Machinery gene
E3S62_RS02595 (E3S62_02595)	comGF	467513..468010 (+)	498	WP_001796472.1	competence type IV pilus minor pilin ComGF	Machinery gene
E3S62_RS02600 (E3S62_02600)	-	468107..468253 (+)	147	WP_001789879.1	hypothetical protein	-
E3S62_RS02605 (E3S62_02605)	-	468243..468767 (+)	525	WP_001015120.1	shikimate kinase	-
E3S62_RS02610 (E3S62_02610)	gcvT	468926..470017 (+)	1092	WP_000093344.1	glycine cleavage system aminomethyltransferase GcvT	-
E3S62_RS02615 (E3S62_02615)	gcvPA	470037..471383 (+)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11301.33 Da
• Isoelectric Point: 8.5268

>NTDB_id=416836 E3S62_RS02580 WP_000472255.1 466574..466885(+) (comGC) [Staphylococcus aureus strain UP_1097]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=416836 E3S62_RS02580 WP_000472255.1 466574..466885(+) (comGC) [Staphylococcus aureus strain UP_1097]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A0U1MLR1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369