Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   H7790_RS02370 Genome accession   NZ_CP060645
Coordinates   446094..446312 (+) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain TSPY1349     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 441094..451312
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7790_RS02340 (H7790_02345) - 442102..442677 (+) 576 WP_002990783.1 uracil-DNA glycosylase family protein -
  H7790_RS02345 (H7790_02350) ybeY 442836..443333 (+) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  H7790_RS02350 (H7790_02355) - 443314..443721 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  H7790_RS02355 (H7790_02360) era 443841..444737 (+) 897 WP_002985743.1 GTPase Era -
  H7790_RS02360 (H7790_02365) - 444757..445233 (+) 477 WP_002985741.1 NUDIX hydrolase -
  H7790_RS02365 - 445539..445793 (-) 255 WP_011106868.1 hypothetical protein -
  H7790_RS02370 (H7790_02370) comE/blpR 446094..446312 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  H7790_RS02375 - 446509..448115 (-) 1607 Protein_436 ABC transporter transmembrane domain-containing protein -
  H7790_RS02380 (H7790_02390) - 448413..448637 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  H7790_RS02385 (H7790_02395) - 448615..448791 (+) 177 WP_002994581.1 hypothetical protein -
  H7790_RS09475 (H7790_02400) - 449086..449397 (+) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  H7790_RS09355 - 449482..449610 (+) 129 WP_002994583.1 hypothetical protein -
  H7790_RS02390 (H7790_02405) - 450009..450235 (+) 227 Protein_441 ComC/BlpC family peptide pheromone/bacteriocin -
  H7790_RS02395 (H7790_02410) - 450284..450601 (+) 318 WP_002994587.1 hypothetical protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=416151 H7790_RS02370 WP_072135532.1 446094..446312(+) (comE/blpR) [Streptococcus pyogenes strain TSPY1349]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=416151 H7790_RS02370 WP_072135532.1 446094..446312(+) (comE/blpR) [Streptococcus pyogenes strain TSPY1349]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417