Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   H7795_RS00690 Genome accession   NZ_CP060641
Coordinates   106577..106861 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain TSPY210     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 101577..111861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7795_RS00665 (H7795_00660) - 103523..103888 (+) 366 WP_002986560.1 DUF1033 family protein -
  H7795_RS00670 (H7795_00665) comGA 103981..104919 (+) 939 WP_023613135.1 competence type IV pilus ATPase ComGA Machinery gene
  H7795_RS00675 (H7795_00670) comGB 104855..105889 (+) 1035 WP_258855794.1 competence type IV pilus assembly protein ComGB Machinery gene
  H7795_RS00680 (H7795_00675) comGC 105891..106217 (+) 327 WP_032465607.1 competence type IV pilus major pilin ComGC Machinery gene
  H7795_RS00685 (H7795_00680) comGD 106192..106620 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  H7795_RS00690 (H7795_00685) comGE 106577..106861 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  H7795_RS00695 (H7795_00690) comGF 106854..107288 (+) 435 WP_023612536.1 competence type IV pilus minor pilin ComGF Machinery gene
  H7795_RS00700 (H7795_00695) comGG 107272..107598 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  H7795_RS00705 (H7795_00700) comGH 107696..108649 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  H7795_RS00710 (H7795_00705) - 108708..109904 (+) 1197 WP_023612537.1 acetate kinase -
  H7795_RS00715 (H7795_00710) - 110091..110399 (+) 309 WP_030126458.1 hypothetical protein -
  H7795_RS00720 (H7795_00715) proC 110482..111252 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=415754 H7795_RS00690 WP_002987779.1 106577..106861(+) (comGE) [Streptococcus pyogenes strain TSPY210]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=415754 H7795_RS00690 WP_002987779.1 106577..106861(+) (comGE) [Streptococcus pyogenes strain TSPY210]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAAATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383