Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GTW28_RS16420 Genome accession   NZ_CP047485
Coordinates   3154964..3155104 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BJQ0005     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3149964..3160104
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GTW28_RS16395 (GTW28_16395) yuxO 3150252..3150632 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  GTW28_RS16400 (GTW28_16400) comA 3150651..3151295 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GTW28_RS16405 (GTW28_16405) - 3151376..3153677 (-) 2302 Protein_3186 histidine kinase -
  GTW28_RS16410 (GTW28_16410) comX 3153693..3153914 (-) 222 WP_014480704.1 competence pheromone ComX -
  GTW28_RS16415 (GTW28_16415) - 3153916..3154779 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  GTW28_RS16420 (GTW28_16420) degQ 3154964..3155104 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GTW28_RS16425 (GTW28_16425) - 3155326..3155451 (+) 126 WP_003228793.1 hypothetical protein -
  GTW28_RS16430 (GTW28_16430) - 3155566..3155934 (+) 369 WP_046381300.1 hypothetical protein -
  GTW28_RS16435 (GTW28_16435) pdeH 3155910..3157139 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  GTW28_RS16440 (GTW28_16440) pncB 3157276..3158748 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GTW28_RS16445 (GTW28_16445) pncA 3158764..3159315 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GTW28_RS16450 (GTW28_16450) yueI 3159412..3159810 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=413705 GTW28_RS16420 WP_003220708.1 3154964..3155104(-) (degQ) [Bacillus subtilis strain BJQ0005]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=413705 GTW28_RS16420 WP_003220708.1 3154964..3155104(-) (degQ) [Bacillus subtilis strain BJQ0005]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment