Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GPY14_RS05610 | Genome accession | NZ_CP046918 |
| Coordinates | 1273441..1273614 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BA-26 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1268441..1278614
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPY14_RS05595 (GPY14_05585) | gcvT | 1269254..1270354 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GPY14_RS05600 (GPY14_05590) | - | 1270778..1272448 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| GPY14_RS05605 (GPY14_05595) | - | 1272470..1273264 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| GPY14_RS05610 (GPY14_05600) | sinI | 1273441..1273614 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| GPY14_RS05615 (GPY14_05605) | sinR | 1273648..1273983 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GPY14_RS05620 (GPY14_05610) | tasA | 1274031..1274816 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| GPY14_RS05625 (GPY14_05615) | sipW | 1274881..1275465 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| GPY14_RS05630 (GPY14_05620) | tapA | 1275437..1276108 (-) | 672 | WP_031378945.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GPY14_RS05635 (GPY14_05625) | - | 1276367..1276696 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| GPY14_RS05640 (GPY14_05630) | - | 1276736..1276915 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GPY14_RS05645 (GPY14_05635) | comGG | 1276972..1277349 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GPY14_RS05650 (GPY14_05640) | comGF | 1277350..1277850 (-) | 501 | WP_257738552.1 | competence type IV pilus minor pilin ComGF | - |
| GPY14_RS05655 (GPY14_05645) | comGE | 1277759..1278073 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| GPY14_RS05660 (GPY14_05650) | comGD | 1278057..1278494 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=409329 GPY14_RS05610 WP_003153105.1 1273441..1273614(+) (sinI) [Bacillus velezensis strain BA-26]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=409329 GPY14_RS05610 WP_003153105.1 1273441..1273614(+) (sinI) [Bacillus velezensis strain BA-26]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |